--- title: "Retatrutide Peptide UK - Compare Prices from 189 Suppliers - PeptideSupermarket®" description: "Compare Retatrutide prices from 189 UK suppliers, from £12.50. Find the cheapest deals, read reviews and save money." url: "https://peptidesupermarket.co.uk/peptide/retatrutide" site: "PeptideSupermarket®" country: "United Kingdom" --- [Home](https://peptidesupermarket.co.uk) › [Peptides](https://peptidesupermarket.co.uk/compare-peptide-prices-uk) › Retatrutide Search # Retatrutide Price Comparison Live prices from 189 UK suppliers, from £12.50, compared side by side so you never overpay. [GLP-1 & metabolic research](https://peptidesupermarket.co.uk/compare-peptide-prices-uk) Prices checked 9 minutes ago We compare prices & may earn a commission. Includes a featured placement — not an endorsement. [Full disclosure](https://peptidesupermarket.co.uk/disclosure). Best Price £23.99 Average £65.61 Highest £249.99 You Could Save 90% 127 results 10mg Featured Supplier [UK SARMs](https://peptidesupermarket.co.uk/suppliers/uk-sarms) ★★★★★ [5.0 reviews](https://peptidereview.co.uk/review/uksarms.com) Retatrutide 10mg In Stock 10mg Lab Tested 95 Confidence £179.99 FREE delivery View Deal Compare 127 prices for Retatrutide. Cheapest: £23.99. Average: £65.61. | Compare | Supplier | Price | Price / mg | Stock | Delivery | Quality | Coupon | Visit | | --- | --- | --- | --- | --- | --- | --- | --- | --- | | | 95 Confidence [PS Labs](https://peptidesupermarket.co.uk/suppliers/ps-labs) ★★★★★ 5.0 (26) Retatrutide | £40.00 | £4.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [Owsa Labs](https://peptidesupermarket.co.uk/suppliers/owsa-labs) ★★★★★ 5.0 (15) Retatrutide | £31.99 | £3.20/mg | Low Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [Red Panda Research](https://peptidesupermarket.co.uk/suppliers/red-panda-research) ★★★★★ 5.0 (20) Retatrutide | £28.99 | £2.90/mg | In Stock | £5.70 | Lab Tested | — | Visit | | | 94 Confidence [Elite peptides](https://peptidesupermarket.co.uk/suppliers/elite-peptides) ★★★★★ 5.0 (46) Retatrutide 10mg | £34.99 | £3.50/mg | In Stock | Free over £60 | Lab Tested | — | Visit | | | 94 Confidence [Peptide Prime](https://peptidesupermarket.co.uk/suppliers/peptide-prime) ★★★★★ 4.9 (12) Retatrutide | £38.00 | £3.80/mg | In Stock | Free | Lab Tested | — | Visit | | | 94 Confidence [Molexa](https://peptidesupermarket.co.uk/suppliers/molexa) ★★★★★ 5.0 (10) Retatrutide | £28.97 | £2.90/mg | In Stock | £5.50 | Lab Tested | — | Visit | | | 92 Confidence [Pyrox Labs](https://peptidesupermarket.co.uk/suppliers/pyrox-labs) ★★★★★ 5.0 (1) Retatrutide | £57.99 | £5.80/mg | In Stock | Free over £50 | Lab Tested | — | Visit | | | 92 Confidence [Raven Peptides](https://peptidesupermarket.co.uk/suppliers/raven-peptides) ★★★★★ 5.0 (8) Retatrutide Pen | £94.99 | £9.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 90 Confidence [Cobalt Peptides](https://peptidesupermarket.co.uk/suppliers/cobalt-peptides) ★★★★★ 5.0 (19) Retatrutide | £35.95 | £3.60/mg | In Stock | Free over £75 | Lab Tested | — | Visit | | | 90 Confidence [QRP Research](https://peptidesupermarket.co.uk/suppliers/qrp-research) ★★★★★ 5.0 (4) Retatrutide | £44.99 | £4.50/mg | In Stock | Free over £150 | Lab Tested | — | Visit | | | 90 Confidence [Peptides Kent](https://peptidesupermarket.co.uk/suppliers/peptides-kent) ★★★★★ 5.0 (2) Retatrutide | £39.99 | £4.00/mg | In Stock | Free | Lab Tested | — | Visit | | | 88 Confidence [Cedar Peptides](https://peptidesupermarket.co.uk/suppliers/cedar-peptides) ★★★★★ 5.0 (1) Retatrutide 10mg | £48.95 | £4.90/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 87 Confidence [PeptideStock](https://peptidesupermarket.co.uk/suppliers/peptidestockcouk) ★★★★★ 4.6 (14) Retatrutide | £29.99 | £3.00/mg | In Stock | Free over £75 | Lab Tested | — | Visit | | | 87 Confidence [Revial Labs](https://peptidesupermarket.co.uk/suppliers/revial-labs) Retatrutide | £57.99 | £5.80/mg | In Stock | Free over £150 | Lab Tested | — | Unavailable | | | 87 Confidence [Astra Labs](https://peptidesupermarket.co.uk/suppliers/astra-labs) Retatrutide 10mg | £59.99 | £6.00/mg | In Stock | Free | Lab Tested | — | Unavailable | | | 85 Confidence [Precision Peptides](https://peptidesupermarket.co.uk/suppliers/precision-peptides) ★★★★★ 5.0 (9) Retatrutide 10mg | £30.39 | £3.04/mg | In Stock | Free | Lab Tested | — | Visit | | | 82 Confidence [Arma Peptides](https://peptidesupermarket.co.uk/suppliers/arma-peptides-2) ★★★★★ 5.0 (2) Retatrutide 10mg | £39.00 | £3.90/mg | In Stock | Free | — | — | Visit | | | 81 Confidence [SPX Labs](https://peptidesupermarket.co.uk/suppliers/spx-labs) Best Retatrutide | £23.99 | £2.40/mg | In Stock | Free over £75 | Lab Tested | — | Visit | | | 80 Confidence [Raccoon Peptides](https://peptidesupermarket.co.uk/suppliers/raccoon-peptides) ★★★★★ 5.0 (1) Retatrutide 10mg | £39.00 | £3.90/mg | In Stock | Free | Lab Tested | — | Unavailable | | | 80 Confidence [JG Peptides Plus](https://peptidesupermarket.co.uk/suppliers/jg-peptides-plus) Retatrutide | £65.00 | £6.50/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 80 Confidence [AllMyPeptides](https://peptidesupermarket.co.uk/suppliers/allmypeptides) Retatrutide 10mg | £41.99 | £4.20/mg | In Stock | Free | Lab Tested | — | Visit | | | 79 Confidence [Pepts](https://peptidesupermarket.co.uk/suppliers/pepts) Retatrutide | £44.99 | £4.50/mg | In Stock | Free over £80 | Lab Tested | — | Visit | | | 77 Confidence [Lucid Peptides](https://peptidesupermarket.co.uk/suppliers/lucid-peptides) Retatrutide Pen | £34.75 | £3.48/mg | In Stock | Free | Lab Tested | — | Visit | | | 76 Confidence [Index Peptides](https://peptidesupermarket.co.uk/suppliers/index-peptides) Retatrutide 10mg | £49.99 | £5.00/mg | In Stock | £9.99 | — | — | Visit | | | 74 Confidence [ExtolX](https://peptidesupermarket.co.uk/suppliers/extolx) ★★★★★ 4.8 (6) Retatrutide | £24.99 | £2.50/mg | In Stock | Free | Lab Tested | — | Visit | Showing 25 of 126 listings Show more suppliers Loading More ways to compare Retatrutide Different views of the same live UK pricing, tuned for how you like to shop. [Best Retatrutide Prices Best prices ranked](https://peptidesupermarket.co.uk/best-retatrutide-prices) [Cheapest Retatrutide Prices Cheapest suppliers compared](https://peptidesupermarket.co.uk/cheapest-retatrutide-prices) [Where to Buy Retatrutide Full buyer's guide](https://peptidesupermarket.co.uk/where-to-buy-retatrutide) [Buy Retatrutide Online UK Cheap Today's hottest deals](https://peptidesupermarket.co.uk/buy-retatrutide-online-uk-cheap) [Retatrutide Price Comparison Live price dashboard](https://peptidesupermarket.co.uk/retatrutide-price-comparison) [Retatrutide UK Supplier Verified UK supplier directory](https://peptidesupermarket.co.uk/retatrutide-uk-supplier) [Retatrutide For Sale Browse listings for sale](https://peptidesupermarket.co.uk/retatrutide-for-sale) Compare another peptide Search PeptideSupermarket® compares prices but doesn't sell products. More All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed. We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed. By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. [Read our full disclosure](https://peptidesupermarket.co.uk/disclosure). ## Retatrutide Profile Extensively Studied Triple GLP-1/GIP/Glucagon Agonist | Weight Loss & Diabetes ### Overview Novel triple hormone receptor agonist targeting GLP-1, GIP, and glucagon receptors. Phase II trials demonstrated 24.2% weight loss at 48 weeks—the highest recorded for obesity medications. ### Mechanism of Action Activates GLP-1 for appetite suppression, GIP for insulin sensitivity, and glucagon for increased energy expenditure and hepatic fat oxidation. ### Key Benefits - Superior weight loss (24.2% at 48 weeks) - Improved glycemic control (HbA1c reduction up to 2.16%) - Enhanced cardiovascular benefits - Hepatic fat reduction (up to 82%) - Triple mechanism addresses obesity through multiple pathways ### Quick Stats Typical Dose 0.5mg starting, titrate up to 8-12mg weekly Frequency Once weekly (same day each week) Cycle Duration Continuous therapy as prescribed Storage Reconstituted: 2-8°C, use within 28 days ## Molecular Information Molecular Weight 4,731.33 Da Length 39 amino acids Type Triple GLP-1/GIP/glucagon agonist Half-Life ~6 days ### Amino Acid Sequence One-letter: `HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPSSGAPPPS` His 1 Histidine Position 1 Aib 2 Aminoisobutyric Acid Position 2 Glu 3 Glutamic Acid Position 3 Gly 4 Glycine Position 4 Thr 5 Threonine Position 5 Phe 6 Phenylalanine Position 6 Thr 7 Threonine Position 7 Ser 8 Serine Position 8 Asp 9 Aspartic Acid Position 9 Val 10 Valine Position 10 Ser 11 Serine Position 11 Ser 12 Serine Position 12 Tyr 13 Tyrosine Position 13 Leu 14 Leucine Position 14 Glu 15 Glutamic Acid Position 15 Gly 16 Glycine Position 16 Gln 17 Glutamine Position 17 Ala 18 Alanine Position 18 Ala 19 Alanine Position 19 Lys 20 Lysine Position 20 Glu 21 Glutamic Acid Position 21 Phe 22 Phenylalanine Position 22 Ile 23 Isoleucine Position 23 Ala 24 Alanine Position 24 Trp 25 Tryptophan Position 25 Leu 26 Leucine Position 26 Val 27 Valine Position 27 Arg 28 Arginine Position 28 Gly 29 Glycine Position 29 Arg 30 Arginine Position 30 Gly 31 Glycine Position 31 Pro 32 Proline Position 32 Ser 33 Serine Position 33 Ser 34 Serine Position 34 Gly 35 Glycine Position 35 Ala 36 Alanine Position 36 Pro 37 Proline Position 37 Pro 38 Proline Position 38 Pro 39 Proline Position 39 Ser 40 Serine Position 40 N-terminus C-terminus Hydrophobic Polar Positive (+) Negative (-) Modified ### Modifications C20 fatty acid conjugation Aib residues for DPP-4 resistance ## Research Indications The following information is derived from published scientific literature and is provided for educational and research reference purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. These peptides are not approved for human use and are sold exclusively for in-vitro laboratory research. Weight Loss Type 2 Diabetes Cardiovascular/Metabolic ## Dosing Protocols ### injectable Weekly subcutaneous injection into abdomen, thigh, or upper arm with site rotation. | Goal | Dose | Frequency | Route | | --- | --- | --- | --- | | Starting Dose (Week 1-4) | 0.5mg | Once weekly | SubQ | | Low Maintenance (Week 4-8) | 1mg | Once weekly | SubQ | | Escalation (Week 8-12) | 2mg | Once weekly | SubQ | | Moderate (Week 12-16) | 4mg | Once weekly | SubQ | | Advanced (Week 16-20) | 8mg | Once weekly | SubQ | | Maximum Efficacy (Week 20+) | 12mg | Once weekly | SubQ | #### Key Tips - Once-weekly administration improves compliance - Extended half-life enables consistent hormone regulation - Minimal systemic burden compared to daily dosing Reconstitution Instructions ## Peptide Interactions #### Tirzepatide Avoid Do not combine with other dual/triple agonists—risk of severe hypoglycemia and excessive GI effects. #### Semaglutide Avoid Do not combine—overlapping GLP-1 agonist mechanisms increase severe hypoglycemia risk. #### Cagrilintide Monitor Both cause significant GI effects. Not recommended without specialist supervision. #### Insulin Monitor May significantly reduce insulin requirements. Monitor blood glucose and adjust insulin doses accordingly. #### Metformin Compatible Safe combination tested in clinical trials. Different mechanisms work complementarily for glucose control. #### SGLT2 Inhibitors Compatible Clinical trials included SGLT2 inhibitors with no safety concerns. #### BPC-157 Compatible Safe combination; BPC-157 may provide GI protective benefits during retatrutide use. #### Oral Contraceptives Monitor Space oral contraceptives by 1 hour before retatrutide due to delayed gastric emptying. ## What to Expect Week 1-2 Initial appetite suppression and mild GI effects as body adapts to triple hormone activation Week 2-4 Noticeable food cravings reduction and portion size decrease; early weight loss (2-5%) Week 4-8 Significant appetite control and steady weight loss (5-10%); improved glucose control Week 8-16 Substantial weight reduction (10-18%) with enhanced energy expenditure Week 16-24 Major weight loss milestone (15-22%) with cardiovascular benefits and liver fat reduction Week 24-48 Maximum clinical efficacy (20-24.2%) with comprehensive metabolic improvements ## Side Effects & Safety #### Common Side Effects - Gastrointestinal effects (nausea, vomiting, diarrhea)—typically mild to moderate - Heart rate increases—common especially in first 24 weeks - Appetite suppression - Mild dehydration #### Monitoring - Cardiovascular status (especially heart rate) - Blood glucose if diabetic - Weight loss rate - Signs of pancreatitis - Gastrointestinal tolerability #### Stop Signs - Severe persistent nausea or vomiting preventing adequate nutrition - Signs of pancreatitis: severe abdominal pain radiating to back - Severe hypoglycemia symptoms: confusion, dizziness, sweating - Excessive weight loss (>3 lbs per week consistently or >25% total body weight) - Gallbladder problems: severe right upper abdominal pain #### Contraindications - Personal or family history of medullary thyroid carcinoma - MEN2 syndrome - Severe renal impairment ## Quality Checklist #### Good Signs - Pharmaceutical-grade white powder with uniform texture - Proper cold chain maintenance (2-8°C refrigeration) - Clear, colorless reconstituted solution without particles - Stable extended half-life effects (consistent appetite suppression between doses) #### Warning Signs - Source verification critical—counterfeit versions circulate due to investigational status #### Bad Signs - Rapid tolerance or effectiveness loss suggests degraded or counterfeit product - Unusual side effect profile may indicate contamination ## Research & References ### Key References 1. 2023 #### [Triple-Hormone-Receptor Agonist Retatrutide for Obesity - A Phase 2 Trial.](https://pubmed.ncbi.nlm.nih.gov/37366315/) PubMed The New England journal of medicine · Jastreboff AM, Kaplan LM, Frías JP, Wu Q, Du Y, Gurbuz S, Coskun T, Haupt A, Milicevic Z, Hartman ML, Retatrutide Phase 2 Obesity Trial Investigators This randomized phase 2 trial in adults with obesity reported dose-dependent body-weight reductions with retatrutide and gastrointestinal adverse events as the most common adverse-event category. [Search PubMed for Retatrutide](https://pubmed.ncbi.nlm.nih.gov/?term=%28%22Retatrutide%22%20OR%20%22Retatrutide%20%28GLP-1%2FGIP%2FGlucagon%20receptor%20tri-agonist%29%22%20OR%20%22LY3437943%22%29) Research Library ## Retatrutide research & guides Plain-English guides and study summaries from published literature. [View all 7](https://peptidesupermarket.co.uk/research/peptide/retatrutide) ![Retatrutide Not Working? Why the Foundation Matters More Than the Dose](https://peptidesupermarket.co.uk/storage/6850/conversions/d33254ed-54c5-45eb-b310-d3ed1fd5d73e-thumbnail.jpg) Guides 7 min ### Retatrutide Not Working? Why the Foundation Matters More Than the Dose Retatrutide is often discussed as a powerful tool for appetite control and body-composition change, but more is not always better. In many cases, hydration, electrolytes, protein intake, thyroid health and overall metabolic stability may matter far more than simply pushing the dose higher. Read article [Retatrutide Not Working? Why the Foundation Matters More Than the Dose](https://peptidesupermarket.co.uk/research/retatrutide-not-working-why-the-foundation-matters-more-than-the-dose) ![Retatrutide: why microdosing is wrong](https://peptidesupermarket.co.uk/storage/6844/conversions/d33254ed-54c5-45eb-b310-d3ed1fd5d73e-thumbnail.jpg) Guides 8 min ### Retatrutide: why microdosing is wrong You’ve probably heard online that microdosing retatrutide daily is the best approach to minimize side effects. And in this video, I’m going to teach you exactly why that’s wrong and show you how to dose this properly. By the end, you’ll understand why the microdosing protocols you see on TikTok and from influencers can’t work, no matter how good they sound. Read article [Retatrutide: why microdosing is wrong](https://peptidesupermarket.co.uk/research/retatrutide-why-microdosing-is-wrong) ![Retatrutide Needs Carbohydrates to Work Properly](https://peptidesupermarket.co.uk/storage/6845/conversions/d33254ed-54c5-45eb-b310-d3ed1fd5d73e-thumbnail.jpg) Guides 8 min ### Retatrutide Needs Carbohydrates to Work Properly Retatrutide and Carbohydrates There’s a loud, confident, aggressively wrong idea floating around the internet: “If you’re using retatrutide, you should go low-carb.” And I’m telling you straight: for a lot of people, low-carb + retatrutide is a performance and body-composition sabotage package—especially if you train, care about lean mass, or want results that don’t boomerang later. Read article [Retatrutide Needs Carbohydrates to Work Properly](https://peptidesupermarket.co.uk/research/Retatrutide%20Needs%20Carbohydrates%20to%20Work%20Properly) ![Microdosing Retatrutide Is Costing You](https://peptidesupermarket.co.uk/storage/6846/conversions/d33254ed-54c5-45eb-b310-d3ed1fd5d73e-thumbnail.jpg) Guides 4 min ### Microdosing Retatrutide Is Costing You The Science Behind GLP-1, GIP, and Glucagon Most explanations you hear are missing the only part that matters: GLP-1, GIP, and glucagon don’t behave the same “alone” as they do together. The combo changes the physics of the system. So if you’re still thinking “GLP-1 = appetite suppression” and calling it a day, you’re watching the trailer and missing the movie. Read article [Microdosing Retatrutide Is Costing You](https://peptidesupermarket.co.uk/research/microdosing-retatrutide-is-costing-you) ![MOTS-C or Retatrutide Which One Is Better](https://peptidesupermarket.co.uk/storage/6847/conversions/d33254ed-54c5-45eb-b310-d3ed1fd5d73e-thumbnail.jpg) Guides 5 min ### MOTS-C or Retatrutide Which One Is Better The Power of Peptides: MOTS-C and Retatrutide People keep asking the wrong question: “When do I take MOTS-C vs Retatrutide?” The right question is: “What failure mode am I trying to fix?” Because yes—both can make you violently insulin sensitive (in the best way). But they do it through completely different control rooms in your biology. One is a mitochondrial operating system rewrite. The other is a triple-axis metabolic demolition and rebuild. Read article [MOTS-C or Retatrutide Which One Is Better](https://peptidesupermarket.co.uk/research/mots-c-or-retatrutide-which-one-is-better) ![What Reta Actually Changes](https://peptidesupermarket.co.uk/storage/6848/conversions/d33254ed-54c5-45eb-b310-d3ed1fd5d73e-thumbnail.jpg) Guides 5 min ### What Reta Actually Changes Reta and Health Benefits Reta isn’t a “weight-loss drug.” If you treat it like that, you’ll misunderstand everything it’s actually doing. The scale is the distraction. The real story is the internal rebuild: liver, blood, inflammation, and—most importantly—your brain’s metabolic control center. Read article [What Reta Actually Changes](https://peptidesupermarket.co.uk/research/what-reta-actually-changes) --- *Add `.md` to any page URL on peptidesupermarket.co.uk for its Markdown version. Index of the site: https://peptidesupermarket.co.uk/llms.txt - full text: https://peptidesupermarket.co.uk/llms-full.txt.*