--- title: "TB-500 Peptide UK - Compare Prices from 211 Suppliers - PeptideSupermarket®" description: "Compare TB-500 prices from 211 UK suppliers, from £4.99. Find the cheapest deals, read reviews and save money." url: "https://peptidesupermarket.co.uk/peptide/tb-500" site: "PeptideSupermarket®" country: "United Kingdom" --- [Home](https://peptidesupermarket.co.uk) › [Peptides](https://peptidesupermarket.co.uk/compare-peptide-prices-uk) › TB-500 Search # TB-500 Price Comparison Live prices from 211 UK suppliers, from £4.99, compared side by side so you never overpay. [Tissue & recovery research](https://peptidesupermarket.co.uk/compare-peptide-prices-uk) Prices checked 2 hours ago We compare prices & may earn a commission. Includes a featured placement — not an endorsement. [Full disclosure](https://peptidesupermarket.co.uk/disclosure). Best Price £12.00 Average £40.48 Highest £249.99 You Could Save 95% 150 results 10mg Compare 150 prices for TB-500. Cheapest: £12.00. Average: £40.48. | Compare | Supplier | Price | Price / mg | Stock | Delivery | Quality | Coupon | Visit | | --- | --- | --- | --- | --- | --- | --- | --- | --- | | | 95 Confidence [PS Labs](https://peptidesupermarket.co.uk/suppliers/ps-labs) ★★★★★ 5.0 (26) TB-500 | £30.00 | £3.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [Biohack Peptides](https://peptidesupermarket.co.uk/suppliers/biohack-peptides) ★★★★★ 4.9 (88) TB-500 | £24.99 | £2.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [SPT Peptide](https://peptidesupermarket.co.uk/suppliers/spt-peptide) ★★★★★ 5.0 (23) TB-500 | £24.00 | £2.40/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [Owsa Labs](https://peptidesupermarket.co.uk/suppliers/owsa-labs) ★★★★★ 5.0 (15) TB-500 | £29.99 | £3.00/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [Zentra Peptides](https://peptidesupermarket.co.uk/suppliers/zentra-peptides) ★★★★★ 5.0 (11) TB-500 - 10mg | £30.00 | £3.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [Ultra Peptides](https://peptidesupermarket.co.uk/suppliers/ultra-peptides-uk) ★★★★★ 5.0 (13) TB-500 | £49.99 | £5.00/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [Red Panda Research](https://peptidesupermarket.co.uk/suppliers/red-panda-research) ★★★★★ 5.0 (20) TB-500 10mg | £21.99 | £2.20/mg | In Stock | £5.70 | Lab Tested | — | Visit | | | 95 Confidence [Molexa](https://peptidesupermarket.co.uk/suppliers/molexa) ★★★★★ 5.0 (10) TB-500 | £29.99 | £3.00/mg | In Stock | £5.50 | Lab Tested | — | Visit | | | 95 Confidence [BioPlex Peptides](https://peptidesupermarket.co.uk/suppliers/bioplex-peptides) ★★★★★ 5.0 (1) TB-500 10mg | £33.99 | £3.40/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [Midshire Labs](https://peptidesupermarket.co.uk/suppliers/midshire-labs) TB-500 | £25.00 | £2.50/mg | In Stock | Free over £50 | Lab Tested | — | Visit | | | 94 Confidence [Elite peptides](https://peptidesupermarket.co.uk/suppliers/elite-peptides) ★★★★★ 5.0 (46) TB-500 10mg | £23.99 | £2.40/mg | In Stock | Free over £60 | Lab Tested | — | Visit | | | 94 Confidence [Peptide Prime](https://peptidesupermarket.co.uk/suppliers/peptide-prime) ★★★★★ 4.9 (12) TB-500 | £29.00 | £2.90/mg | In Stock | Free | Lab Tested | — | Visit | | | 92 Confidence [D&L Peptides](https://peptidesupermarket.co.uk/suppliers/dl-peptides) TB-500 10mg | £30.00 | £3.00/mg | In Stock | Free | Lab Tested | — | Unavailable | | | 90 Confidence [Cobalt Peptides](https://peptidesupermarket.co.uk/suppliers/cobalt-peptides) ★★★★★ 5.0 (19) TB-500 | £26.95 | £2.70/mg | Out of Stock | Free over £75 | Lab Tested | — | Visit | | | 90 Confidence [Apex Biolabs](https://peptidesupermarket.co.uk/suppliers/apex-biolabs) ★★★★★ 5.0 (20) TB-500 | £23.00 | £2.30/mg | In Stock | Free | Lab Tested | — | Visit | | | 88 Confidence [Cedar Peptides](https://peptidesupermarket.co.uk/suppliers/cedar-peptides) ★★★★★ 5.0 (1) TB-500 10mg | £29.95 | £3.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 88 Confidence [Adria](https://peptidesupermarket.co.uk/suppliers/adria) TB-500 10mg | £43.29 | £4.33/mg | In Stock | Free | — | — | Visit | | | 87 Confidence [PeptideStock](https://peptidesupermarket.co.uk/suppliers/peptidestockcouk) ★★★★★ 4.6 (14) TB-500 10mg | £34.99 | £3.50/mg | In Stock | Free over £75 | Lab Tested | — | Visit | | | 87 Confidence [Revial Labs](https://peptidesupermarket.co.uk/suppliers/revial-labs) TB-500 10mg | £32.99 | £3.30/mg | In Stock | Free over £150 | Lab Tested | — | Unavailable | | | 85 Confidence [Precision Peptides](https://peptidesupermarket.co.uk/suppliers/precision-peptides) ★★★★★ 5.0 (9) TB-500 10mg | £24.99 | £2.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 85 Confidence [Fat Pig Peptides](https://peptidesupermarket.co.uk/suppliers/fat-pig-peptides) TB-500 | £33.19 | £3.32/mg | In Stock | £5.15 | Lab Tested | — | Visit | | | 82 Confidence [Arma Peptides](https://peptidesupermarket.co.uk/suppliers/arma-peptides-2) ★★★★★ 5.0 (2) TB-500 | £35.00 | £3.50/mg | In Stock | Free | — | — | Visit | | | 80 Confidence [Optimus Labs](https://peptidesupermarket.co.uk/suppliers/optimus-labs) TB-500 | £24.50 | £2.45/mg | In Stock | Free over £30 | Lab Tested | — | Visit | | | 80 Confidence [Raccoon Peptides](https://peptidesupermarket.co.uk/suppliers/raccoon-peptides) ★★★★★ 5.0 (1) TB-500 10mg | £24.90 | £2.49/mg | In Stock | Free | Lab Tested | — | Unavailable | | | 80 Confidence [JG Peptides Plus](https://peptidesupermarket.co.uk/suppliers/jg-peptides-plus) TB-500 | £30.00 | £3.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | Showing 25 of 150 listings Show more suppliers Loading More ways to compare TB-500 Different views of the same live UK pricing, tuned for how you like to shop. [Best TB-500 Prices Best prices ranked](https://peptidesupermarket.co.uk/best-tb-500-prices) [Cheapest TB-500 Prices Cheapest suppliers compared](https://peptidesupermarket.co.uk/cheapest-tb-500-prices) [Where to Buy TB-500 Full buyer's guide](https://peptidesupermarket.co.uk/where-to-buy-tb-500) [Buy TB-500 Online UK Cheap Today's hottest deals](https://peptidesupermarket.co.uk/buy-tb-500-online-uk-cheap) [TB-500 Price Comparison Live price dashboard](https://peptidesupermarket.co.uk/tb-500-price-comparison) [TB-500 UK Supplier Verified UK supplier directory](https://peptidesupermarket.co.uk/tb-500-uk-supplier) [TB-500 For Sale Browse listings for sale](https://peptidesupermarket.co.uk/tb-500-for-sale) Compare another peptide Search PeptideSupermarket® compares prices but doesn't sell products. More All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed. We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed. By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. [Read our full disclosure](https://peptidesupermarket.co.uk/disclosure). ## TB-500 Profile Well Studied Synthetic Fragment (17-23) of Thymosin Beta-4 ### Overview A synthetic 7-amino acid fragment corresponding to the actin-binding region of thymosin beta-4, originally developed for equine use with retained tissue repair properties. TB-500 acts as principal actin-sequestering protein, regulating cell migration, promoting angiogenesis, reducing inflammation, and activating stem cell differentiation. ### Mechanism of Action Acts as principal actin-sequestering protein, regulating cell migration, promoting angiogenesis, reducing inflammation, and activating stem cell differentiation for comprehensive regenerative effects. ### Key Benefits - Superior systemic tissue repair - Accelerated muscle, tendon, and ligament healing - Enhanced cell migration and angiogenesis - Comprehensive regenerative effects - Neuroprotective properties ### Quick Stats Typical Dose 2-5mg per injection (higher doses for serious injuries) Frequency 2-3x weekly (e.g., Monday, Wednesday, Friday) Cycle Duration 6-8 weeks for active healing Storage Reconstituted: 2-8°C, use within 28 days ## Molecular Information Molecular Weight 4,963.44 Da Length 43 amino acids Type Thymosin fragment Half-Life ~2 hours ### Amino Acid Sequence One-letter: `?SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES` Ac 1 Ac Position 1 Ser 2 Serine Position 2 Asp 3 Aspartic Acid Position 3 Lys 4 Lysine Position 4 Pro 5 Proline Position 5 Asp 6 Aspartic Acid Position 6 Met 7 Methionine Position 7 Ala 8 Alanine Position 8 Glu 9 Glutamic Acid Position 9 Ile 10 Isoleucine Position 10 Glu 11 Glutamic Acid Position 11 Lys 12 Lysine Position 12 Phe 13 Phenylalanine Position 13 Asp 14 Aspartic Acid Position 14 Lys 15 Lysine Position 15 Ser 16 Serine Position 16 Lys 17 Lysine Position 17 Leu 18 Leucine Position 18 Lys 19 Lysine Position 19 Lys 20 Lysine Position 20 Thr 21 Threonine Position 21 Glu 22 Glutamic Acid Position 22 Thr 23 Threonine Position 23 Gln 24 Glutamine Position 24 Glu 25 Glutamic Acid Position 25 Lys 26 Lysine Position 26 Asn 27 Asparagine Position 27 Pro 28 Proline Position 28 Leu 29 Leucine Position 29 Pro 30 Proline Position 30 Ser 31 Serine Position 31 Lys 32 Lysine Position 32 Glu 33 Glutamic Acid Position 33 Thr 34 Threonine Position 34 Ile 35 Isoleucine Position 35 Glu 36 Glutamic Acid Position 36 Gln 37 Glutamine Position 37 Glu 38 Glutamic Acid Position 38 Lys 39 Lysine Position 39 Gln 40 Glutamine Position 40 Ala 41 Alanine Position 41 Gly 42 Glycine Position 42 Glu 43 Glutamic Acid Position 43 Ser 44 Serine Position 44 N-terminus C-terminus Hydrophobic Polar Positive (+) Negative (-) Modified ### Modifications N-terminal acetylation for enhanced stability ## Research Indications The following information is derived from published scientific literature and is provided for educational and research reference purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. These peptides are not approved for human use and are sold exclusively for in-vitro laboratory research. Tissue Repair Athletic Recovery Neurological ## Dosing Protocols ### injectable Subcutaneous or intramuscular injection. Flexible timing with no empty stomach requirement. Can be injected near injury site for localized effect. | Goal | Dose | Frequency | Route | | --- | --- | --- | --- | | General tissue repair | 2-3mg | 2x weekly | SubQ or IM | | Serious injury recovery | 4-5mg | 3x weekly | SubQ near injury site | | Athletic enhancement | 2-3mg | 2x weekly | SubQ | | Chronic conditions | 3-4mg | 2-3x weekly | SubQ or IM | | Maintenance | 2mg | 1-2x weekly | SubQ | | Post-surgical recovery | 3-5mg | 3x weekly | SubQ | #### Key Tips - Subcutaneous injection at belly, thigh, or shoulder - Intramuscular option for larger muscles - Flexible timing - no empty stomach required Reconstitution Instructions ### topical Topical formulations available for specific applications including wound healing and eye conditions. | Goal | Dose | Frequency | Route | | --- | --- | --- | --- | | Chronic wound healing | 0.01-0.03% concentration | 1-2x daily | Topical application | | Dry eye treatment | Eye drops formulation | As directed | Ophthalmic | #### Key Tips - Direct application to affected area - Non-invasive option - Suitable for surface wounds and eye conditions ## Peptide Interactions #### BPC-157 Synergistic Complementary healing mechanisms with enhanced tissue repair when combined (Wolverine Stack). #### Ipamorelin Compatible May enhance tissue sensitivity to growth hormone effects. #### CJC-1295 Synergistic Combined tissue repair with GH-releasing effects for comprehensive recovery. #### IGF-1 Synergistic Enhanced muscle and tissue regeneration through complementary growth pathways. #### GHRP-6 Compatible No negative interactions; potential enhanced recovery. #### Melanotan II Compatible Different receptor families with no pathway overlap. ## What to Expect Week 1-2 Reduced inflammation and improved tissue sensation Week 2-4 Accelerated healing rate and improved tissue quality Week 4-8 Maximum tissue repair and regenerative benefits Week 6-12 Continued improvement in tissue strength and function ## Side Effects & Safety #### Common Side Effects - Generally minimal side effects - Possible mild injection site reactions - Temporary fatigue in some users #### Stop Signs - Persistent or worsening injection site infections - Unusual swelling or prolonged redness - Severe allergic reactions - Unexpected systemic symptoms - Concerning health changes #### Contraindications - Active cancer treatment (due to angiogenic effects) - Pregnancy or breastfeeding - Immunosuppressive medications (consult provider) - WADA prohibited for competitive athletes ## Quality Checklist #### Good Signs - White lyophilized powder - fine, evenly distributed with light fluffy texture - Clear, colorless solution after reconstitution with no particles - Proper vacuum seal intact with secure rubber stopper #### Warning Signs - Slight powder clumping acceptable if completely dissolves with gentle swirling #### Bad Signs - Colored or crystalline powder (yellow/brown indicates degradation) - Persistent cloudiness, floating particles, or precipitation - Damaged vial seal or contamination signs ## Research & References ### Latest Research March 2024 #### TB-500 Metabolism and Detection in Clinical Applications Journal of Chromatography B Analysis of TB-500 metabolic pathways and bioavailability in human subjects for clinical dosing protocols. June 2021 #### Thymosin Beta-4 in Anti-Aging Regenerative Therapies Cells Journal Review of TB-500's ability to reactivate embryonic developmental processes in adult organs for regenerative medicine. ### Key References 1. 2012 #### Dermal Wound Healing Study Significant acceleration in wound healing rates in patients with chronic pressure ulcers and venous stasis ulcers compared to placebo in Phase 2 human trial. 2. 2016 #### Cardiac Tissue Regeneration TB-500 pre-treated endothelial cells improved left ventricular function by greater than 50% in post-MI subjects in human clinical trial. 3. 2015 #### Muscle Fiber Regeneration Improved skeletal muscle fiber regeneration in dystrophin-deficient mice, showing potential for muscular dystrophy treatment. 4. 2014 #### Corneal Healing Research Topical TB-500 significantly improved signs and symptoms of moderate to severe dry eye with lasting effects in Phase 2 human trial. [Search PubMed for TB-500](https://pubmed.ncbi.nlm.nih.gov/?term=%28%22TB-500%22%20OR%20%22Thymosin%20Beta-4%20Fragment%20%28TB-500%29%22%20OR%20%22Thymosin%20Beta-4%20Fragment%22%20OR%20%22Ac-LKKTETQ%22%29) Research Library ## TB-500 research & guides Plain-English guides and study summaries from published literature. [View all 2](https://peptidesupermarket.co.uk/research/peptide/tb-500) ![TB-500 and Cardiac Repair: Why Regenerative Peptide Discussions Focus on Fibrosis and Recovery](https://peptidesupermarket.co.uk/storage/2568/conversions/01KN97MC42A233C3EGDRMAQAYC-thumbnail.jpg) Guides min ### TB-500 and Cardiac Repair: Why Regenerative Peptide Discussions Focus on Fibrosis and Recovery TB-500 is often discussed as a regenerative peptide rather than a simple anti-inflammatory tool. In cardiac conversations, that usually means interest in fibrosis, tissue remodelling and recovery after structural stress. Read article [TB-500 and Cardiac Repair: Why Regenerative Peptide Discussions Focus on Fibrosis and Recovery](https://peptidesupermarket.co.uk/research/tb-500-and-cardiac-repair-why-regenerative-peptide-discussions-focus-on-fibrosis-and-recovery) ![Why you should take TB500 Every Month](https://peptidesupermarket.co.uk/storage/105/conversions/01KH4BPZV1JHE77QEK51SWSZFX-thumbnail.jpg) Guides 6 min ### Why you should take TB500 Every Month What TB-500 actually is TB-500 isn’t a “drug.” It’s a signal—a message your body already understands. But there’s a huge point of confusion that ruins results: Thymosin Beta-4 (TB-4) is the full-length molecule (43 amino acids). TB-500 is a short, highly active fragment (commonly referenced as ~17 amino acids) that carries the core “get up and repair” message in a tighter, more stable package. Think of TB-4 as the whole book. TB-500 is the chapter that contains the plot. Read article [Why you should take TB500 Every Month](https://peptidesupermarket.co.uk/research/why-you-should-take-tb500-every-month) --- *Add `.md` to any page URL on peptidesupermarket.co.uk for its Markdown version. Index of the site: https://peptidesupermarket.co.uk/llms.txt - full text: https://peptidesupermarket.co.uk/llms-full.txt.*