--- title: "Tesamorelin Peptide UK - Compare Prices from 196 Suppliers - PeptideSupermarket®" description: "Compare Tesamorelin prices from 196 UK suppliers, from £13.00. Find the cheapest deals, read reviews and save money." url: "https://peptidesupermarket.co.uk/peptide/tesamorelin" site: "PeptideSupermarket®" country: "United Kingdom" --- [Home](https://peptidesupermarket.co.uk) › [Peptides](https://peptidesupermarket.co.uk/compare-peptide-prices-uk) › Tesamorelin Search # Tesamorelin Price Comparison Live prices from 196 UK suppliers, from £13.00, compared side by side so you never overpay. [Growth hormone axis](https://peptidesupermarket.co.uk/compare-peptide-prices-uk) Prices checked 9 hours ago We compare prices & may earn a commission. Includes a featured placement — not an endorsement. [Full disclosure](https://peptidesupermarket.co.uk/disclosure). Best Price £18.99 Average £57.57 Highest £289.99 You Could Save 93% 146 results 10mg Compare 146 prices for Tesamorelin. Cheapest: £18.99. Average: £57.57. | Compare | Supplier | Price | Price / mg | Stock | Delivery | Quality | Coupon | Visit | | --- | --- | --- | --- | --- | --- | --- | --- | --- | | | 95 Confidence [PS Labs](https://peptidesupermarket.co.uk/suppliers/ps-labs) ★★★★★ 5.0 (26) Tesamorelin 10mg | £40.00 | £4.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [Biohack Peptides](https://peptidesupermarket.co.uk/suppliers/biohack-peptides) ★★★★★ 4.9 (88) Tesamorelin | £34.99 | £3.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [SPT Peptide](https://peptidesupermarket.co.uk/suppliers/spt-peptide) ★★★★★ 5.0 (23) Tesamorelin | £60.00 | £6.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [SPT Peptide](https://peptidesupermarket.co.uk/suppliers/spt-peptide) ★★★★★ 5.0 (23) Tesamorelin | £110.00 | £11.00/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [Owsa Labs](https://peptidesupermarket.co.uk/suppliers/owsa-labs) ★★★★★ 5.0 (15) Tesamorelin | £59.99 | £6.00/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [Zentra Peptides](https://peptidesupermarket.co.uk/suppliers/zentra-peptides) ★★★★★ 5.0 (11) Tesamorelin - 10mg | £42.99 | £4.30/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [Ultra Peptides](https://peptidesupermarket.co.uk/suppliers/ultra-peptides-uk) ★★★★★ 5.0 (13) Tesamorelin | £44.99 | £4.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [Red Panda Research](https://peptidesupermarket.co.uk/suppliers/red-panda-research) ★★★★★ 5.0 (20) Tesamorelin 10mg | £29.99 | £3.00/mg | In Stock | £5.70 | Lab Tested | — | Visit | | | 95 Confidence [Molexa](https://peptidesupermarket.co.uk/suppliers/molexa) ★★★★★ 5.0 (10) Tesamorelin | £38.99 | £3.90/mg | In Stock | £5.50 | Lab Tested | — | Visit | | | 95 Confidence [Alpha Peptides®](https://peptidesupermarket.co.uk/suppliers/alpha-peptides) ★★★★★ 5.0 (4) Tesamorelin | £35.00 | £3.50/mg | In Stock | Free over £100 | Lab Tested | — | Visit | | | 95 Confidence [BioPlex Peptides](https://peptidesupermarket.co.uk/suppliers/bioplex-peptides) ★★★★★ 5.0 (1) Tesamorelin 10mg (GHRH) | £24.99 | £2.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 95 Confidence [Midshire Labs](https://peptidesupermarket.co.uk/suppliers/midshire-labs) Tesamorelin | £40.00 | £4.00/mg | In Stock | Free over £50 | Lab Tested | — | Visit | | | 94 Confidence [Elite peptides](https://peptidesupermarket.co.uk/suppliers/elite-peptides) ★★★★★ 5.0 (46) Tesamorelin 10mg | £31.19 | £3.12/mg | In Stock | Free over £60 | Lab Tested | — | Visit | | | 94 Confidence [Peptide Prime](https://peptidesupermarket.co.uk/suppliers/peptide-prime) ★★★★★ 4.9 (12) Tesamorelin | £38.00 | £3.80/mg | In Stock | Free | Lab Tested | — | Visit | | | 92 Confidence [Pyrox Labs](https://peptidesupermarket.co.uk/suppliers/pyrox-labs) ★★★★★ 5.0 (1) Tesamorelin | £62.99 | £6.30/mg | In Stock | Free over £50 | Lab Tested | — | Visit | | | 92 Confidence [Raven Peptides](https://peptidesupermarket.co.uk/suppliers/raven-peptides) ★★★★★ 5.0 (8) Tesamorelin 10mg | £34.99 | £3.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 92 Confidence [Raven Peptides](https://peptidesupermarket.co.uk/suppliers/raven-peptides) ★★★★★ 5.0 (8) Tesamorelin 10mg Pen Pen | £47.95 | £4.80/mg | In Stock | Free | Lab Tested | — | Visit | | | 90 Confidence [Cobalt Peptides](https://peptidesupermarket.co.uk/suppliers/cobalt-peptides) ★★★★★ 5.0 (19) Tesamorelin | £42.95 | £4.30/mg | In Stock | Free over £75 | Lab Tested | — | Visit | | | 90 Confidence [QRP Research](https://peptidesupermarket.co.uk/suppliers/qrp-research) ★★★★★ 5.0 (4) Tesamorelin 10mg | £42.50 | £4.25/mg | In Stock | Free over £150 | Lab Tested | — | Visit | | | 88 Confidence [Cedar Peptides](https://peptidesupermarket.co.uk/suppliers/cedar-peptides) ★★★★★ 5.0 (1) Tesamorelin 10mg | £46.95 | £4.70/mg | Out of Stock | Free over £100 | Lab Tested | — | Visit | | | 88 Confidence [Adria](https://peptidesupermarket.co.uk/suppliers/adria) Tesamorelin 10mg | £80.59 | £8.06/mg | In Stock | Free | — | — | Visit | | | 87 Confidence [PeptideStock](https://peptidesupermarket.co.uk/suppliers/peptidestockcouk) ★★★★★ 4.6 (14) Tesamorelin | £37.99 | £3.80/mg | In Stock | Free over £75 | Lab Tested | — | Visit | | | 87 Confidence [Revial Labs](https://peptidesupermarket.co.uk/suppliers/revial-labs) Tesamorelin | £44.99 | £4.50/mg | In Stock | Free over £150 | Lab Tested | — | Unavailable | | | 85 Confidence [Precision Peptides](https://peptidesupermarket.co.uk/suppliers/precision-peptides) ★★★★★ 5.0 (9) Tesamorelin 10mg | £34.99 | £3.50/mg | In Stock | Free | Lab Tested | — | Visit | | | 85 Confidence [Fat Pig Peptides](https://peptidesupermarket.co.uk/suppliers/fat-pig-peptides) Tesamorelin 10mg | £49.99 | £5.00/mg | In Stock | £5.15 | Lab Tested | — | Visit | Showing 25 of 146 listings Show more suppliers Loading More ways to compare Tesamorelin Different views of the same live UK pricing, tuned for how you like to shop. [Best Tesamorelin Prices Best prices ranked](https://peptidesupermarket.co.uk/best-tesamorelin-prices) [Cheapest Tesamorelin Prices Cheapest suppliers compared](https://peptidesupermarket.co.uk/cheapest-tesamorelin-prices) [Where to Buy Tesamorelin Full buyer's guide](https://peptidesupermarket.co.uk/where-to-buy-tesamorelin) [Buy Tesamorelin Online UK Cheap Today's hottest deals](https://peptidesupermarket.co.uk/buy-tesamorelin-online-uk-cheap) [Tesamorelin Price Comparison Live price dashboard](https://peptidesupermarket.co.uk/tesamorelin-price-comparison) [Tesamorelin UK Supplier Verified UK supplier directory](https://peptidesupermarket.co.uk/tesamorelin-uk-supplier) [Tesamorelin For Sale Browse listings for sale](https://peptidesupermarket.co.uk/tesamorelin-for-sale) Compare another peptide Search PeptideSupermarket® compares prices but doesn't sell products. More All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed. We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed. By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. [Read our full disclosure](https://peptidesupermarket.co.uk/disclosure). ## Tesamorelin Profile Fda Approved FDA Approved GHRH Analog | Visceral Fat Reduction ### Overview Tesamorelin is an FDA-approved synthetic GHRH analog designed for HIV-associated lipodystrophy treatment. It provides selective visceral fat targeting with 15-20% visceral fat reduction in clinical trials while preserving subcutaneous fat. ### Mechanism of Action Subcutaneous injection provides optimal bioavailability for GHRH receptor binding and pulsatile GH release stimulation, selectively targeting visceral adipose tissue while sparing subcutaneous fat. ### Key Benefits - FDA-approved formulation - Selective visceral fat targeting (15-20% reduction) - Proven clinical efficacy - Standardized dosing - 37% liver fat reduction in NAFLD - Preserved subcutaneous fat ### Quick Stats Typical Dose 1.4-2mg daily (FDA-approved: 2mg for HIV lipodystrophy) Frequency Once daily (evening preferred for GH rhythm) Cycle Duration Continuous therapy for maintained benefits Storage Powder: 20-25°C. Egrifta SV: use immediately. Egrifta WR: room temp up to 7 days ## Molecular Information Molecular Weight 5,135.9 Da Length 44 amino acids Type GHRH analog Half-Life 26-38 minutes ### Amino Acid Sequence One-letter: `HADGIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL` His 1 Histidine Position 1 Ala 2 Alanine Position 2 Asp 3 Aspartic Acid Position 3 Gly 4 Glycine Position 4 Ile 5 Isoleucine Position 5 Phe 6 Phenylalanine Position 6 Thr 7 Threonine Position 7 Asn 8 Asparagine Position 8 Ser 9 Serine Position 9 Tyr 10 Tyrosine Position 10 Arg 11 Arginine Position 11 Lys 12 Lysine Position 12 Val 13 Valine Position 13 Leu 14 Leucine Position 14 Gly 15 Glycine Position 15 Gln 16 Glutamine Position 16 Leu 17 Leucine Position 17 Ser 18 Serine Position 18 Ala 19 Alanine Position 19 Arg 20 Arginine Position 20 Lys 21 Lysine Position 21 Leu 22 Leucine Position 22 Leu 23 Leucine Position 23 Gln 24 Glutamine Position 24 Asp 25 Aspartic Acid Position 25 Ile 26 Isoleucine Position 26 Met 27 Methionine Position 27 Ser 28 Serine Position 28 Arg 29 Arginine Position 29 Gln 30 Glutamine Position 30 Gln 31 Glutamine Position 31 Gly 32 Glycine Position 32 Glu 33 Glutamic Acid Position 33 Ser 34 Serine Position 34 Asn 35 Asparagine Position 35 Gln 36 Glutamine Position 36 Glu 37 Glutamic Acid Position 37 Arg 38 Arginine Position 38 Gly 39 Glycine Position 39 Ala 40 Alanine Position 40 Arg 41 Arginine Position 41 Ala 42 Alanine Position 42 Arg 43 Arginine Position 43 Leu 44 Leucine Position 44 N-terminus C-terminus Hydrophobic Polar Positive (+) Negative (-) Modified ### Modifications Modified with trans-3-hexenoic acid at N-terminus for enhanced stability ## Research Indications The following information is derived from published scientific literature and is provided for educational and research reference purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. These peptides are not approved for human use and are sold exclusively for in-vitro laboratory research. Weight Loss Metabolic Body Composition ## Dosing Protocols ### injectable Subcutaneous injection to abdomen (avoid navel ±2 inches). Evening injection preferred for GH circadian rhythm alignment. | Goal | Dose | Frequency | Route | | --- | --- | --- | --- | | HIV Lipodystrophy (FDA-approved) | 1.4mg | Once daily | SubQ | | Visceral Fat Reduction | 2mg | Once daily | SubQ | | Anti-aging/Body Composition | 1-2mg | 5-7x weekly | SubQ | | NAFLD Treatment | 2mg | Once daily (12 months) | SubQ | | Cognitive Enhancement | 1mg | Once daily (20 weeks) | SubQ | #### Key Tips - Abdomen (avoid navel ±2 inches) - Rotate injection sites - Evening injection preferred Reconstitution Instructions ## Peptide Interactions #### Ipamorelin Monitor Synergistic GH stimulation; monitor IGF-1 levels. #### CJC-1295 Monitor Combined use may elevate IGF-1 supraphysiologically. #### Sermorelin Monitor Similar mechanism; risk of excessive effects at higher doses. #### Insulin Monitor 3.3-fold diabetes risk increase; monitor glucose closely. #### Metformin Compatible May mitigate glucose intolerance associated with tesamorelin. #### Prednisone Monitor Decreases corticosteroid effectiveness. #### Octreotide Avoid Blocks GH release, negates tesamorelin effects. #### Growth Hormone Avoid Redundant; risk of acromegaly-like effects. ## What to Expect Week 1-2 IGF-1 levels begin to rise, possible mild water retention or joint discomfort Week 4-6 Early metabolic changes; improved energy/sleep Week 8-12 Visible visceral fat reduction begins, waist circumference may decrease Week 12-26 Peak effects achieved with significant body composition improvements ## Side Effects & Safety #### Common Side Effects - Injection site reactions (17%) - Joint pain (13%) - Water retention #### Monitoring - Monitor blood glucose regularly - 3.3-fold increased diabetes risk documented - IGF-1 levels should be checked monthly - 47% exceed normal range at 26 weeks #### Stop Signs - Development of diabetes or severe glucose intolerance (HbA1c ≥6.5%) - Signs of malignancy - Severe hypersensitivity reactions - Excessive IGF-1 elevation (>2 SD above normal) with acromegaly symptoms #### Contraindications - Active malignancy - Pituitary disorders - Pregnancy ## Quality Checklist #### Good Signs - FDA-approved formulations (Egrifta SV/WR from licensed pharmacy) - White crystalline powder (uniform, cake-like) - Clear reconstituted solution (colorless, no particles) - Proper packaging (sealed vials, intact stoppers) #### Warning Signs - Compounded formulations may have quality/potency variability #### Bad Signs - Discolored or cloudy solution (yellow/brown indicates degradation) - Visible particles or precipitate ## Research & References ### Key References 1. 2010 #### LIPO-010 FDA Pivotal Trial Significant visceral adipose tissue reduction (-24 ± 41 cm² vs +2 ± 35 cm² placebo, p < 0.001) in HIV patients over 26 weeks. 2. 2011 #### CTR-1011 Extended Safety Study 69% achieved ≥8% VAT reduction vs 33% placebo at 26-52 weeks. 3. 2019 #### NAFLD Treatment Trial 37% liver fat reduction over 12 months with fibrosis progression prevention. 4. 2012 #### Cognitive Enhancement Study Improved executive function and verbal memory in healthy elderly and mild cognitive impairment cohorts at 1mg daily. [Search PubMed for Tesamorelin](https://pubmed.ncbi.nlm.nih.gov/?term=%28%22Tesamorelin%22%20OR%20%22Tesamorelin%20%28Growth%20Hormone-Releasing%20Factor%20Analogue%22%20OR%20%22Egrifta%20SV%22%20OR%20%22Egrifta%20WR%22%29) Research Library ## Tesamorelin research & guides Plain-English guides and study summaries from published literature. [View all 4](https://peptidesupermarket.co.uk/research/peptide/tesamorelin) ![Low Growth Hormone and Ageing: Why It Matters Beyond Bodybuilding](https://peptidesupermarket.co.uk/storage/2569/conversions/01KN9AZGHTPD4J4YVRAPHFKEPG-thumbnail.jpg) Guides 4 min ### Low Growth Hormone and Ageing: Why It Matters Beyond Bodybuilding Growth hormone is often treated as a niche topic for athletes, but many longevity discussions place it much closer to the centre of whole-body function. Here is a balanced look at why low growth hormone is frequently linked to poorer recovery, body-composition decline and slower ageing resilience. Read article [Low Growth Hormone and Ageing: Why It Matters Beyond Bodybuilding](https://peptidesupermarket.co.uk/research/low-growth-hormone-and-ageing-why-it-matters-beyond-bodybuilding) ![The Only FDA-Approved “GH Peptide” for Fat Reduction (and how to use it intelligently)](https://peptidesupermarket.co.uk/storage/131/conversions/01KH8ZP2DDF7ATAMQ873KP7YHX-thumbnail.jpg) Guides 5 min ### The Only FDA-Approved “GH Peptide” for Fat Reduction (and how to use it intelligently) The Only FDA-Approved “GH Peptide” for Fat Reduction (and how to use it intelligently) Tesamorelin gets marketed as the “visceral fat peptide,” and compared to other growth-hormone peptides like CJC-1295 and sermorelin, it’s usually positioned as the top-tier option. Tesamorelin is the only one that’s actually FDA-approved for fat reduction (originally for HIV-associated lipodystrophy). That approval gives it a level of clinical legitimacy most other GH-related peptides simply don’t have. Read article [The Only FDA-Approved “GH Peptide” for Fat Reduction (and how to use it intelligently)](https://peptidesupermarket.co.uk/research/the-only-fda-approved-gh-peptide-for-fat-reduction-and-how-to-use-it-intelligently) ![Tesamorelin: is it really better for visceral fat?](https://peptidesupermarket.co.uk/storage/125/conversions/01KH6RJ907QFKVSTVV5GY5MPE4-thumbnail.jpg) Guides 5 min ### Tesamorelin: is it really better for visceral fat? Tesamorelin gets called “the visceral fat peptide” because it’s the only growth-hormone–pathway peptide with real clinical data measuring visceral fat by CT scan in humans. Mechanistically, it’s doing the same core job as other GHRH analogs — it stimulates your pituitary to release growth hormone, which then drives IGF-1 — but the evidence base is what’s different, not some special visceral-fat-only switch. Read article [Tesamorelin: is it really better for visceral fat?](https://peptidesupermarket.co.uk/research/tesamorelin-is-it-really-better-for-visceral-fat) ![The Solution: Tesamorelin](https://peptidesupermarket.co.uk/storage/102/conversions/01KH69JWVXQYZE3C816PQST7EY-thumbnail.jpg) Guides 5 min ### The Solution: Tesamorelin The Solution: Tesamorelin Don’t add the hormone. Fix the signal. The solution isn’t to pour in growth hormone from the outside. The solution is to fix the signal. Tesamorelin is not growth hormone. It’s the upstream command that tells your system to produce its own growth hormone the way it was designed to. This isn’t “here’s a fish.” It’s “here’s how to fish.” Read article [The Solution: Tesamorelin](https://peptidesupermarket.co.uk/research/The-Solution-Tesamorelin) --- *Add `.md` to any page URL on peptidesupermarket.co.uk for its Markdown version. Index of the site: https://peptidesupermarket.co.uk/llms.txt - full text: https://peptidesupermarket.co.uk/llms-full.txt.*