PEPTIDE SUPERMARKET
PEPTIDE SUPERMARKET
Live Price Comparison
weight management diabetes

Retatrutide Price Comparison

Compare live Retatrutide prices from every UK supplier — side-by-side in seconds so you never overpay.

Prices last checked:

Promotes significant weight loss Improves glycemic control Reduces appetite and food intake Lowers HbA1c levels Improves cardiovascular risk markers Once-weekly dosing schedule

Based on published research findings only. Not medical claims. For laboratory research use only.

Suppliers
89
From
£34.99
Prices
In-vitro research use only. We compare prices & may earn a commission. We do not sell or supply any products. This page includes a featured supplier placement, which has not been independently verified or endorsed. Listing does not constitute a recommendation. Full disclosure.
228 results
89 suppliers · 19 dosages · 228 products
Featured Supplier
UK SARMs logo
UK SARMs
★★★★★ 4.7

Retatrutide 5mg

In Stock 5mg Lab Tested
£94.99
FREE delivery
Best Price
Save 70%
Dr P Research logo
Dr P Research
★★★★★ 5.0

Retatrutide 5mg

In Stock 5mg Lab Tested
£34.99
FREE delivery
Acepep logo
Acepep

Retatrutide 5mg

£34.99
In Stock 5mg Lab Tested
Save 70% FREE delivery
Unavailable
Elite peptides logo
Elite peptides

Retatrutide 10mg

£36.99
In Stock 10mg Lab Tested
Save 80% FREE delivery
Precision Peptides logo
Precision Peptides

Retatrutide 10mg

£37.99
In Stock 10mg Lab Tested
Save 80% FREE delivery
Raccoon Peptides logo
★ 5.0
Raccoon Peptides

Retatrutide 10mg

£39.00
In Stock 10mg Lab Tested
Save 79% FREE delivery
Peptide Prime logo
Peptide Prime

Retatrutide 10mg

£40.00
In Stock 10mg Lab Tested
Save 78% FREE delivery
AllMyPeptides logo
AllMyPeptides

Retatrutide 10mg

£41.99
In Stock 10mg Lab Tested
Save 77% FREE delivery
Certa Peptides logo
Certa Peptides

Retatrutide 5mg

£44.49
In Stock 5mg Lab Tested
Save 61% FREE delivery
CK Peptides logo
★ 5.0
CK Peptides

Retatrutide 10mg

£49.99
£47.49
In Stock 10mg Lab Tested Coupon
Save 74% FREE delivery
AJ Research Labs logo
AJ Research Labs

Retatrutide 10mg

£48.00
In Stock 10mg
Save 74% FREE delivery
Kensington Labs logo
★ 4.7
Kensington Labs

Retatrutide 5mg

£49.95
In Stock 5mg Lab Tested
Save 57% FREE delivery
CMSR Labs logo
CMSR Labs

Retatrutide 5mg

£49.95
In Stock 5mg
Save 57% FREE delivery
Peptide Solutions logo
Peptide Solutions

Retatrutide 10mg

£49.99
In Stock 10mg
Save 73% FREE delivery
Flex Peptides logo
Flex Peptides

Retatrutide 20mg

£50.00
In Stock 20mg Lab Tested
Save 74% FREE delivery
NASS Peptides logo
NASS Peptides

Retatrutide 5mg

£54.50
In Stock 5mg Lab Tested
Save 53% FREE delivery
Unavailable
Precision Research UK logo
Precision Research UK

Retatrutide 10mg

£54.95
In Stock 10mg
Save 70% FREE delivery
Wild Ginger Peptides logo
Wild Ginger Peptides

Retatrutide 10mg

£54.95
In Stock 10mg Lab Tested
Save 70% FREE over £75
Unavailable
Peak Peptides logo
Peak Peptides

Retatrutide 10mg

£55.00
In Stock 10mg
Save 70% FREE delivery
Sculpt Peptide logo
Sculpt Peptide

Retatrutide 10mg

£55.00
In Stock 10mg
Save 70% FREE delivery
JG Peptides Plus logo
JG Peptides Plus

Retatrutide 5mg

£55.99
In Stock 5mg Lab Tested
Save 51% FREE over £50
Pondok Peptides logo
Pondok Peptides

Retatrutide 10mg

£59.00
In Stock 10mg
Save 68% FREE delivery
Raccoon Peptides logo
★ 5.0
Raccoon Peptides

Retatrutide 20mg

£59.00
In Stock 20mg Lab Tested
Save 69% FREE delivery
Tested Peptides logo
★ 4.8
Tested Peptides

Retatrutide 5mg

£59.99
In Stock 5mg Lab Tested
Save 48% FREE delivery
Peptides Lab UK logo
Peptides Lab UK

Retatrutide 5mg

£59.99
In Stock 5mg Lab Tested
Save 48% FREE delivery
PeptiLab logo
★ 2.7
PeptiLab

Retatrutide 10mg

£59.99
In Stock 10mg Lab Tested
Save 68% FREE delivery
Acepep logo
Acepep

Retatrutide 10mg

£59.99
In Stock 10mg Lab Tested
Save 68% FREE delivery
Unavailable
Astra Labs logo
Astra Labs

Retatrutide 10mg

£59.99
In Stock 10mg Lab Tested
Save 68% FREE delivery
Bodylab logo
Bodylab

Retatrutide 5mg

£60.00
In Stock 5mg Lab Tested
Save 48% FREE delivery
Brit Peptides logo
Brit Peptides

Retatrutide 5mg

£60.00
In Stock 5mg Lab Tested
Save 48% FREE delivery
Anglo Peptides logo
Anglo Peptides

Retatrutide 10mg

£60.00
In Stock 10mg Lab Tested
Save 68% FREE over £100
Bionik Peptides logo
Bionik Peptides

Retatrutide 10mg

£60.00
In Stock 10mg
Save 68% FREE delivery
XL Peptides logo
★ 4.7
XL Peptides

Retatrutide 25mg

£60.00
In Stock 25mg Lab Tested
Save 54% FREE delivery
NASS Peptides logo
NASS Peptides

Retatrutide 10mg

£62.50
In Stock 10mg Lab Tested
Save 66% FREE delivery
Unavailable
Dr P Research logo
★ 5.0
Dr P Research

Retatrutide 10mg

£64.99
In Stock 10mg Lab Tested
Save 65% FREE delivery
The Peptides Outlet logo
The Peptides Outlet

Retatrutide 10mg

£64.99
In Stock 10mg
Save 65% FREE delivery
Great British Peptides logo
Great British Peptides

Retatrutide 10mg

£64.99
In Stock 10mg
Save 65% FREE delivery
Unavailable
Precision Peptides logo
Precision Peptides

Retatrutide 20mg

£64.99
In Stock 20mg Lab Tested
Save 66% FREE delivery
RC Peptides logo
RC Peptides

Retatrutide 10mg

£65.00
In Stock 10mg Lab Tested
Save 65% FREE delivery
Buy Reta EU logo
Buy Reta EU

Retatrutide 10mg

£65.00
In Stock 10mg
Save 65% FREE delivery
Blue Peak Peptides logo
Blue Peak Peptides

Retatrutide 10mg

£66.95
In Stock 10mg Lab Tested
Save 64% FREE delivery
Bio Hack London logo
Bio Hack London

Retatrutide 10mg

£67.50
In Stock 10mg Lab Tested
Save 64% FREE delivery
Lumia Lab logo
Lumia Lab

Retatrutide 10mg

£69.95
In Stock 10mg Lab Tested
Save 62% FREE delivery
Imperial Peptides logo
★ 4.9
Imperial Peptides

Retatrutide 10mg

£69.99
In Stock 10mg Lab Tested
Save 62% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 10mg

£70.00
In Stock 10mg
Save 62% FREE delivery
Ideal Labz logo
Ideal Labz

Retatrutide 10mg

£73.90
In Stock 10mg Lab Tested
Save 60% FREE delivery
Raccoon Peptides logo
★ 5.0
Raccoon Peptides

Retatrutide 30mg

£74.00
In Stock 30mg Lab Tested
Save 75% FREE delivery
Future Peptides logo
Future Peptides

Retatrutide 10mg

£74.39
In Stock 10mg Lab Tested
Save 60% FREE delivery
Kensington Labs logo
★ 4.7
Kensington Labs

Retatrutide 10mg

£74.95
In Stock 10mg Lab Tested
Save 60% FREE delivery
CMSR Labs logo
CMSR Labs

Retatrutide 10mg

£74.95
In Stock 10mg
Save 60% FREE delivery
Nexum Peptides logo
Nexum Peptides

Retatrutide 10mg

£74.99
In Stock 10mg Lab Tested
Save 60% FREE delivery
Peptide Lab UK logo
Peptide Lab UK

Retatrutide 5mg

£75.00
In Stock 5mg
Save 35% FREE delivery
Power Peptides logo
Power Peptides

Retatrutide 10mg

£75.00
In Stock 10mg
Save 60% FREE delivery
Buy Retatrutide logo
Buy Retatrutide

Retatrutide 10mg

£75.00
In Stock 10mg Lab Tested
Save 60% FREE delivery
Peptides 4U logo
Peptides 4U

Retatrutide 10mg

£75.00
In Stock 10mg Lab Tested
Save 60% FREE delivery
Nova Peptides logo
Nova Peptides

Retatrutide 10mg

£75.00
In Stock 10mg Lab Tested
Save 60% + £5.00 delivery
Peptide Prime logo
Peptide Prime

Retatrutide 30mg

£75.00
In Stock 30mg Lab Tested
Save 74% FREE delivery
Peptiology logo
★ 4.4
Peptiology

Retatrutide 5mg

£77.00
In Stock 5mg Lab Tested
Save 33% FREE delivery
NASS Peptides logo
NASS Peptides

Retatrutide 20mg

£77.50
In Stock 20mg Lab Tested
Save 59% FREE delivery
Unavailable
Core Peptides logo
Core Peptides

Retatrutide 5mg

£78.06
In Stock 5mg Lab Tested
Save 32% FREE delivery
Unavailable
Precision Research UK logo
Precision Research UK

Retatrutide 20mg

£79.95
In Stock 20mg
Save 58% FREE delivery
Tested Peptides logo
★ 4.8
Tested Peptides

Retatrutide 10mg

£79.99
In Stock 10mg Lab Tested
Save 57% FREE delivery
Bethesda Pharma logo
Bethesda Pharma

Retatrutide 10mg

£79.99
In Stock 10mg
Save 57% FREE delivery
Orbitrex Peptides logo
Orbitrex Peptides

Retatrutide 10mg

£79.99
In Stock 10mg Lab Tested
Save 57% FREE delivery
JG Peptides Plus logo
JG Peptides Plus

Retatrutide 10mg

£79.99
In Stock 10mg Lab Tested
Save 57% FREE over £50
Peptiva Biohealth logo
Peptiva Biohealth

Retatrutide 20mg

£79.99
In Stock 20mg Lab Tested
Save 58% FREE delivery
Astra Labs logo
Astra Labs

Retatrutide 20mg

£79.99
In Stock 20mg Lab Tested
Save 58% FREE delivery
Regen Peptides logo
Regen Peptides

Retatrutide 10mg

£80.00
In Stock 10mg
Save 57% FREE delivery
The Secret Beauty Store logo
The Secret Beauty Store

Retatrutide 10mg

£80.00
In Stock 10mg
Save 57% FREE delivery
Sculpt Peptide logo
Sculpt Peptide

Retatrutide 20mg

£80.00
In Stock 20mg
Save 58% FREE delivery
D&L Peptides logo
D&L Peptides

Retatrutide 20mg

£80.00
In Stock 20mg Lab Tested
Save 58% FREE delivery
Chroma Peptides logo
Chroma Peptides

Retatrutide 10mg

£81.83
In Stock 10mg Lab Tested
Save 56% FREE delivery
Online Peptides UK logo
Online Peptides UK

Retatrutide 10mg

£82.00
In Stock 10mg
Save 56% FREE delivery
Ideal Labz logo
Ideal Labz

Retatrutide 15mg

£84.90
In Stock 15mg Lab Tested
Save 39% FREE delivery
Apex Receptor logo
★ 1.8
Apex Receptor

Retatrutide 5mg

£84.99
In Stock 5mg Lab Tested
Save 26% FREE over £50
Star Biotech and Health logo
Star Biotech and Health

Retatrutide 10mg

£84.99
In Stock 10mg Lab Tested
Save 54% FREE delivery
Global Peptides logo
Global Peptides

Retatrutide 20mg

£84.99
In Stock 20mg
Save 55% FREE delivery
Acepep logo
Acepep

Retatrutide 15mg

£84.99
In Stock 15mg Lab Tested
Save 39% FREE delivery
Unavailable
Ranked Peptides logo
Ranked Peptides

Retatrutide 30mg

£85.00
In Stock 30mg
Save 71% FREE delivery
Pendragon Peptides logo
Pendragon Peptides

Retatrutide 20mg

£86.63
In Stock 20mg
Save 54% FREE delivery
Nova Peptide logo
Nova Peptide

Retatrutide 10mg

£88.00
In Stock 10mg Lab Tested
Save 53% FREE delivery
Bio Peptides UK logo
Bio Peptides UK

Retatrutide 10mg

£89.00
In Stock 10mg Lab Tested
Save 52% FREE delivery
Bio Hack London logo
Bio Hack London

Retatrutide 20mg

£89.00
In Stock 20mg Lab Tested
Save 53% FREE delivery
Elite peptides logo
Elite peptides

Retatrutide 30mg

£89.00
In Stock 30mg Lab Tested
Save 69% FREE delivery
Precision Peptides logo
Precision Peptides

Retatrutide 30mg

£89.49
In Stock 30mg Lab Tested
Save 69% FREE delivery
UK Peptide Shop logo
UK Peptide Shop

Retatrutide 5mg

£89.99
In Stock 5mg
Save 22% FREE delivery
Unavailable
Brit Peptides logo
Brit Peptides

Retatrutide 10mg

£89.99
In Stock 10mg Lab Tested
Save 52% FREE delivery
Peak Peptides logo
Peak Peptides

Retatrutide 20mg

£89.99
In Stock 20mg
Save 52% FREE delivery
Dr P Research logo
★ 5.0
Dr P Research

Retatrutide 15mg

£89.99
In Stock 15mg Lab Tested
Save 36% FREE delivery
Union Biolabs logo
Union Biolabs

Retatrutide 10mg

£90.00
In Stock 10mg Lab Tested
Save 52% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 10mg

£90.00
In Stock 10mg Pen
Save 52% FREE delivery
Alpha Peptides logo
Alpha Peptides

Retatrutide 10mg

£92.00
In Stock 10mg
Save 51% FREE delivery
UK Peptides logo
UK Peptides

Retatrutide 5mg

£94.99
In Stock 5mg Lab Tested
Save 17% FREE delivery
Peptide Lab UK logo
Peptide Lab UK

Retatrutide 10mg

£95.00
In Stock 10mg Lab Tested
Save 49% FREE delivery
The Peptide Code logo
The Peptide Code

Retatrutide 20mg

£95.00
In Stock 20mg
Save 50% FREE delivery
NASS Peptides logo
NASS Peptides

Retatrutide 30mg

£97.50
In Stock 30mg Lab Tested
Save 67% FREE delivery
Unavailable
Peptides Lab UK logo
Peptides Lab UK

Retatrutide 10mg

£98.99
In Stock 10mg Lab Tested
Save 47% FREE delivery
Bodylab logo
Bodylab

Retatrutide 10mg

£99.00
In Stock 10mg Lab Tested
Save 47% FREE delivery
Raccoon Peptides logo
★ 5.0
Raccoon Peptides

Retatrutide 40mg

£99.00
In Stock 40mg Lab Tested
Save 69% FREE delivery
Kensington Labs logo
★ 4.7
Kensington Labs

Retatrutide 15mg

£99.95
In Stock 15mg Lab Tested
Save 29% FREE delivery
CMSR Labs logo
CMSR Labs

Retatrutide 15mg

£99.95
In Stock 15mg
Save 29% FREE delivery
JG Peptides Plus logo
JG Peptides Plus

Retatrutide 15mg

£99.99
In Stock 15mg Lab Tested
Save 29% FREE over £50
Vionex Peptides logo
Vionex Peptides

Retatrutide 10mg

£100.00
In Stock 10mg Lab Tested
Save 46% FREE delivery
Peptide Lab UK logo
Peptide Lab UK

Retatrutide 20mg

£100.00
In Stock 20mg Pen
Save 47% FREE delivery
Peptagenix Peptides logo
Peptagenix Peptides

Retatrutide 20mg

£100.00
In Stock 20mg Lab Tested
Save 47% FREE delivery
Vitality Peptides logo
★ 4.7
Vitality Peptides

Retatrutide 10mg

£104.90
In Stock 10mg Lab Tested
Save 44% FREE delivery
Unavailable
Great British Peptides logo
Great British Peptides

Retatrutide 20mg

£104.99
In Stock 20mg
Save 44% FREE delivery
Unavailable
Anglo Peptides logo
Anglo Peptides

Retatrutide 20mg

£105.00
In Stock 20mg Lab Tested
Save 44% FREE over £100
Regenix Peptides logo
Regenix Peptides

Retatrutide 20mg

£105.00
In Stock 20mg Lab Tested
Save 44% FREE delivery
Power Peptides logo
Power Peptides

Retatrutide 20mg

£105.00
In Stock 20mg
Save 44% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 20mg

£105.00
In Stock 20mg
Save 44% FREE delivery
Peptiology logo
★ 4.4
Peptiology

Retatrutide 10mg

£105.99
In Stock 10mg Lab Tested
Save 43% FREE delivery
NASS Peptides logo
NASS Peptides

Retatrutide 40mg

£109.50
In Stock 40mg Lab Tested
Save 66% FREE delivery
Unavailable
Biolab logo
★ 4.0
Biolab

Retatrutide 5mg

£109.99
In Stock 5mg Lab Tested
Save 4% FREE delivery
Peptides of London logo
Peptides of London

Retatrutide 5mg

£109.99
In Stock 5mg Lab Tested
Save 4% FREE delivery
UK Peptide Shop logo
UK Peptide Shop

Retatrutide 10mg

£109.99
In Stock 10mg
Save 41% FREE delivery
Unavailable
Alpha Peptides logo
Alpha Peptides

Retatrutide 10mg

£110.00
In Stock 10mg Pen
Save 41% FREE delivery
Union Biolabs logo
Union Biolabs

Retatrutide 20mg

£110.00
In Stock 20mg Lab Tested
Save 42% FREE delivery
Pen Peptide logo
Pen Peptide

Retatrutide 6mg

£112.00
In Stock 6mg Pen
FREE delivery
Ideal Labz logo
Ideal Labz

Retatrutide 20mg

£114.90
In Stock 20mg Lab Tested
Save 39% FREE delivery
Peptides of London logo
Peptides of London

Retatrutide 5mg

£114.99
In Stock 5mg Lab Tested
FREE delivery
Maxx Labs logo
Maxx Labs

Retatrutide 20mg

£119.99
In Stock 20mg
Save 36% FREE delivery
Astra Labs logo
Astra Labs

Retatrutide 30mg

£119.99
In Stock 30mg Lab Tested
Save 59% FREE delivery
Peptiology logo
★ 4.4
Peptiology

Retatrutide 20mg

£120.00
In Stock 20mg Lab Tested
Save 36% FREE delivery
Biopro Store logo
Biopro Store

Retatrutide 20mg

£120.00
In Stock 20mg Pen
Save 36% FREE delivery
RC Peptides logo
RC Peptides

Retatrutide 20mg

£120.00
In Stock 20mg Lab Tested
Save 36% FREE delivery
Peptagenix Peptides logo
Peptagenix Peptides

Retatrutide 20mg

£120.00
In Stock 20mg Lab Tested Pen
Save 36% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 20mg

£120.00
In Stock 20mg Pen
Save 36% FREE delivery
Pendragon Peptides logo
Pendragon Peptides

Retatrutide 30mg

£121.28
In Stock 30mg
Save 58% FREE delivery
NASS Peptides logo
NASS Peptides

Retatrutide 50mg

£124.50
In Stock 50mg Lab Tested
Save 84% FREE delivery
Unavailable
CMSR Labs logo
CMSR Labs

Retatrutide 20mg

£124.95
In Stock 20mg
Save 34% FREE delivery
BioPlex Peptides logo
BioPlex Peptides

Retatrutide 20mg

£124.99
In Stock 20mg Lab Tested
Save 34% FREE delivery
UK Peptide Shop logo
UK Peptide Shop

Retatrutide 20mg

£124.99
In Stock 20mg
Save 34% FREE delivery
Unavailable
The Peptide Code logo
The Peptide Code

Retatrutide 30mg

£125.00
In Stock 30mg
Save 57% FREE delivery
Future Peptides logo
Future Peptides

Retatrutide 20mg

£125.99
In Stock 20mg Lab Tested
Save 33% FREE delivery
Raccoon Peptides logo
★ 5.0
Raccoon Peptides

Retatrutide 50mg

£129.00
In Stock 50mg Lab Tested
Save 83% FREE delivery
Lumia Lab logo
Lumia Lab

Retatrutide 20mg

£129.95
In Stock 20mg Lab Tested
Save 31% FREE delivery
Dr P Research logo
★ 5.0
Dr P Research

Retatrutide 20mg

£129.99
In Stock 20mg Lab Tested
Save 31% FREE delivery
Clova logo
Clova

Retatrutide 20mg

£129.99
In Stock 20mg Lab Tested Pen
Save 31% FREE delivery
Orbitrex Peptides logo
Orbitrex Peptides

Retatrutide 20mg

£129.99
In Stock 20mg Lab Tested
Save 31% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 30mg

£130.00
In Stock 30mg
Save 55% FREE delivery
The Secret Beauty Store logo
The Secret Beauty Store

Retatrutide 25mg

£130.00
In Stock 25mg
FREE delivery
JG Peptides Plus logo
JG Peptides Plus

Retatrutide 20mg

£134.99
In Stock 20mg Lab Tested
Save 29% FREE over £50
Alpha Peptides logo
Alpha Peptides

Retatrutide 20mg

£135.00
In Stock 20mg
Save 29% FREE delivery
Peptiology logo
★ 4.4
Peptiology

Retatrutide 30mg

£135.00
In Stock 30mg Lab Tested
Save 54% FREE delivery
Tested Peptides logo
★ 4.8
Tested Peptides

Retatrutide 20mg

£139.99
In Stock 20mg Lab Tested
Save 26% FREE delivery
Brit Peptides logo
Brit Peptides

Retatrutide 20mg

£139.99
In Stock 20mg Lab Tested
Save 26% FREE delivery
Genetic Research logo
Genetic Research

Retatrutide 20mg

£139.99
In Stock 20mg Lab Tested
Save 26% FREE delivery
Peptides Lab UK logo
Peptides Lab UK

Retatrutide 15mg

£139.99
In Stock 15mg Lab Tested
FREE delivery
Peptide Lab UK logo
Peptide Lab UK

Retatrutide 20mg

£140.00
In Stock 20mg Lab Tested
Save 26% FREE delivery
Sculpt Peptide logo
Sculpt Peptide

Retatrutide 40mg

£140.00
In Stock 40mg
Save 57% FREE delivery
NASS Peptides logo
NASS Peptides

Retatrutide 60mg

£142.50
In Stock 60mg Lab Tested
Save 43% FREE delivery
Unavailable
Get Peptide Pens logo
Get Peptide Pens

Retatrutide 30mg

£145.00
In Stock 30mg Lab Tested Pen
Save 50% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 30mg

£145.00
In Stock 30mg Pen
Save 50% FREE delivery
Bio Peptides UK logo
Bio Peptides UK

Retatrutide 20mg

£149.00
In Stock 20mg Lab Tested
Save 21% FREE delivery
Bio Peptides UK logo
Bio Peptides UK

Retatrutide

£149.00
In Stock 20mg Lab Tested
Save 21% FREE delivery
Raccoon Peptides logo
★ 5.0
Raccoon Peptides

Retatrutide 60mg

£149.00
In Stock 60mg Lab Tested
Save 40% FREE delivery
Apex Receptor logo
★ 1.8
Apex Receptor

Retatrutide 10mg

£149.99
In Stock 10mg Lab Tested
Save 19% FREE over £50
Star Biotech and Health logo
Star Biotech and Health

Retatrutide 20mg

£149.99
In Stock 20mg Lab Tested
Save 21% FREE delivery
Peptiva Biohealth logo
Peptiva Biohealth

Retatrutide 40mg

£149.99
In Stock 40mg Lab Tested
Save 54% FREE delivery
Regen Peptides logo
Regen Peptides

Retatrutide 20mg

£150.00
In Stock 20mg
Save 21% FREE delivery
Alpha Peptides logo
Alpha Peptides

Retatrutide 20mg

£150.00
In Stock 20mg Pen
Save 21% FREE delivery
D&L Peptides logo
D&L Peptides

Retatrutide 40mg

£150.00
In Stock 40mg Lab Tested
Save 54% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 50mg

£150.00
In Stock 50mg
Save 81% FREE delivery
GB Peptides logo
GB Peptides

Retatrutide 30mg

£150.00
In Stock 30mg
Save 49% FREE delivery
Peptides 4U logo
Peptides 4U

Retatrutide 30mg

£150.00
In Stock 30mg Lab Tested
Save 49% FREE delivery
Nova Peptides logo
Nova Peptides

Retatrutide 30mg

£150.00
In Stock 30mg Lab Tested
Save 49% + £5.00 delivery
Wholesale Peptides logo
Wholesale Peptides

Retatrutide 100mg

£156.00
In Stock 100mg
Save 88% FREE delivery
Chroma Peptides logo
Chroma Peptides

Retatrutide 20mg

£156.35
In Stock 20mg Lab Tested
Save 17% FREE delivery
Bonafide Peptides logo
Bonafide Peptides

Retatrutide 40mg

£160.00
In Stock 40mg Pen
Save 51% FREE delivery
Pendragon Peptides logo
Pendragon Peptides

Retatrutide 40mg

£161.70
In Stock 40mg Pen
Save 50% FREE delivery
Biopro Store logo
Biopro Store

Retatrutide 40mg

£165.00
In Stock 40mg Pen
Save 49% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 50mg

£165.00
In Stock 50mg Pen
Save 79% FREE delivery
JG Peptides Plus logo
JG Peptides Plus

Retatrutide 30mg

£165.99
In Stock 30mg Lab Tested
Save 43% FREE over £50
Peptides of London logo
Peptides of London

Retatrutide 10mg

£169.99
In Stock 10mg Lab Tested
Save 9% FREE delivery
Vionex Peptides logo
Vionex Peptides

Retatrutide 20mg

£169.99
In Stock 20mg Lab Tested
Save 10% FREE delivery
Union Biolabs logo
Union Biolabs

Retatrutide 40mg

£170.00
In Stock 40mg Lab Tested
Save 48% FREE delivery
RC Peptides logo
RC Peptides

Retatrutide 30mg

£170.00
In Stock 30mg Lab Tested
Save 42% FREE delivery
Bio Peptides UK logo
Bio Peptides UK

Retatrutide

£179.00
In Stock 30mg Lab Tested
Save 39% FREE delivery
Pendragon Peptides logo
Pendragon Peptides

Retatrutide 60mg

£179.03
In Stock 60mg Pen
Save 28% FREE delivery
Lumia Lab logo
Lumia Lab

Retatrutide 30mg

£179.95
In Stock 30mg Lab Tested
Save 38% FREE delivery
Peptides Lab UK logo
Peptides Lab UK

Retatrutide 20mg

£179.99
In Stock 20mg Lab Tested
Save 5% FREE delivery
Clova logo
Clova

Retatrutide 40mg

£179.99
In Stock 40mg Lab Tested Pen
Save 44% FREE delivery
Bodylab logo
Bodylab

Retatrutide 20mg

£180.00
In Stock 20mg Lab Tested
Save 5% FREE delivery
The Peptide Code logo
The Peptide Code

Retatrutide 40mg

£180.00
In Stock 40mg Pen
Save 44% FREE delivery
Buy Retatrutide logo
Buy Retatrutide

Retatrutide 30mg

£180.00
In Stock 30mg Lab Tested
Save 38% FREE delivery
Union Biolabs logo
Union Biolabs

Retatrutide 30mg

£180.00
In Stock 30mg Lab Tested
Save 38% FREE delivery
GB Peptides logo
GB Peptides

Retatrutide 60mg

£180.00
In Stock 60mg
Save 28% FREE delivery
Biopep Uk logo
Biopep Uk

Retatrutide 60mg

£180.00
In Stock 60mg
Save 28% FREE delivery
DN Research logo
DN Research

Retatrutide 10mg

£186.01
In Stock 10mg
(€217.00 EUR) FREE delivery
Vitality Peptides logo
★ 4.7
Vitality Peptides

Retatrutide 20mg

£188.90
In Stock 20mg Lab Tested
FREE delivery
Unavailable
Labgrade Peptides logo
Labgrade Peptides

Retatrutide 40mg

£189.99
In Stock 40mg Pen
Save 41% FREE delivery
Peptide Lab UK logo
Peptide Lab UK

Retatrutide 40mg

£189.99
In Stock 40mg Pen
Save 41% FREE delivery
Pen Peptide logo
Pen Peptide

Retatrutide 12mg

£192.00
In Stock 12mg Pen
FREE delivery
Clova logo
Clova

Retatrutide 60mg

£199.99
In Stock 60mg Lab Tested Pen
Save 20% FREE delivery
Anglo Peptides logo
Anglo Peptides

Retatrutide 40mg

£200.00
In Stock 40mg Lab Tested
Save 38% FREE over £100
Alpha Peptides logo
Alpha Peptides

Retatrutide 30mg

£200.00
In Stock 30mg Pen
Save 31% FREE delivery
Alpha Peptides logo
Alpha Peptides

Retatrutide 40mg

£205.00
In Stock 40mg
Save 37% FREE delivery
Wholesale Peptides logo
Wholesale Peptides

Retatrutide 150mg

£208.00
In Stock 150mg
FREE delivery
The Secret Beauty Store logo
The Secret Beauty Store

Retatrutide 50mg

£210.00
In Stock 50mg
Save 73% FREE delivery
Regen Peptides logo
Regen Peptides

Retatrutide 30mg

£210.00
In Stock 30mg
Save 28% FREE delivery
Orbitrex Peptides logo
Orbitrex Peptides

Retatrutide 36mg

£219.99
In Stock 36mg Lab Tested
FREE delivery
Bodylab logo
Bodylab

Retatrutide 30mg

£220.00
In Stock 30mg Lab Tested
Save 25% FREE delivery
Chroma Peptides logo
Chroma Peptides

Retatrutide 30mg

£224.54
In Stock 30mg Lab Tested
Save 23% FREE delivery
Get Peptide Pens logo
Get Peptide Pens

Retatrutide 60mg

£225.00
In Stock 60mg Lab Tested
Save 10% FREE delivery
Lumia Lab logo
Lumia Lab

Retatrutide 40mg

£229.95
In Stock 40mg Lab Tested
Save 29% FREE delivery
Alpha Peptides logo
Alpha Peptides

Retatrutide 40mg

£235.00
In Stock 40mg Pen
Save 27% FREE delivery
Alpha Peptides logo
Alpha Peptides

Retatrutide 50mg

£235.00
In Stock 50mg
Save 69% FREE delivery
Star Biotech and Health logo
Star Biotech and Health

Retatrutide 40mg

£239.99
In Stock 40mg Lab Tested
Save 26% FREE delivery
Vitality Peptides logo
★ 4.7
Vitality Peptides

Retatrutide 30mg

£245.90
In Stock 30mg Lab Tested
Save 16% FREE delivery
Unavailable
Peptides Lab UK logo
Peptides Lab UK

Retatrutide 30mg

£246.00
In Stock 30mg Lab Tested
Save 16% FREE delivery
Adaptog Research logo
Adaptog Research

Retatrutide 40mg

£249.00
In Stock 40mg Pen
Save 23% FREE delivery
Union Biolabs logo
Union Biolabs

Retatrutide 60mg

£250.00
In Stock 60mg Lab Tested
FREE delivery
Alpha Peptides logo
Alpha Peptides

Retatrutide 50mg

£255.00
In Stock 50mg Pen
Save 67% FREE delivery
Dr P Research logo
★ 5.0
Dr P Research

Retatrutide 50mg

£259.99
In Stock 50mg Lab Tested
Save 66% FREE delivery
Chroma Peptides logo
Chroma Peptides

Retatrutide 40mg

£272.78
In Stock 40mg Lab Tested
Save 16% FREE delivery
Wholesale Peptides logo
Wholesale Peptides

Retatrutide 200mg

£280.00
In Stock 200mg
FREE delivery
DN Research logo
DN Research

Retatrutide 30mg

£291.45
In Stock 30mg Pen
(€340.00 EUR) FREE delivery
Regen Peptides logo
Regen Peptides

Retatrutide 50mg

£300.00
In Stock 50mg
Save 61% FREE delivery
Bodylab logo
Bodylab

Retatrutide 40mg

£324.00
In Stock 40mg Lab Tested
FREE delivery
Wholesale Peptides logo
Wholesale Peptides

Retatrutide 300mg

£330.00
In Stock 300mg
FREE delivery
Wholesale Peptides logo
Wholesale Peptides

Retatrutide 400mg

£370.00
In Stock 400mg
FREE delivery
Wholesale Peptides logo
Wholesale Peptides

Retatrutide 500mg

£416.00
In Stock 500mg
FREE delivery
Wholesale Peptides logo
Wholesale Peptides

Retatrutide 600mg

£455.00
In Stock 600mg
FREE delivery
Peptides of London logo
Peptides of London

Retatrutide 50mg

£769.95
In Stock 50mg Lab Tested
FREE delivery
Peptides of London logo
Peptides of London

Retatrutide 100mg

£1,279.95
In Stock 100mg Lab Tested
FREE delivery

More ways to compare Retatrutide

Different views of the same live UK pricing, tuned for how you like to shop.

Best Retatrutide Prices Best prices ranked Cheapest Retatrutide Prices Cheapest suppliers compared Where to Buy Retatrutide Full buyer's guide Buy Retatrutide Online UK Cheap Today's hottest deals Retatrutide Price Comparison Live price dashboard Retatrutide UK Supplier Verified UK supplier directory Retatrutide For Sale Browse listings for sale

Compare another peptide

Research use only. Peptide Supermarket compares prices but doesn't sell products. All listings are for in-vitro laboratory research.

All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed.

Peptides on this site are intended exclusively for in-vitro laboratory research — not for human or animal consumption, therapeutic use, or self-administration.

We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed.

By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. Read our full disclosure.

Retatrutide Profile

Extensively Studied

Triple GLP-1/GIP/Glucagon Agonist | Weight Loss & Diabetes

Overview

Novel triple hormone receptor agonist targeting GLP-1, GIP, and glucagon receptors. Phase II trials demonstrated 24.2% weight loss at 48 weeks—the highest recorded for obesity medications.

Mechanism of Action

Activates GLP-1 for appetite suppression, GIP for insulin sensitivity, and glucagon for increased energy expenditure and hepatic fat oxidation.

Key Benefits

  • Superior weight loss (24.2% at 48 weeks)
  • Improved glycemic control (HbA1c reduction up to 2.16%)
  • Enhanced cardiovascular benefits
  • Hepatic fat reduction (up to 82%)
  • Triple mechanism addresses obesity through multiple pathways

Quick Stats

Typical Dose
0.5mg starting, titrate up to 8-12mg weekly
Frequency
Once weekly (same day each week)
Cycle Duration
Continuous therapy as prescribed
Storage
Reconstituted: 2-8°C, use within 28 days

Molecular Information

Molecular Weight
4,731.33 Da
Length
39 amino acids
Type
Triple GLP-1/GIP/glucagon agonist
Half-Life
~6 days

Amino Acid Sequence

One-letter: HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPSSGAPPPS
His
1

Histidine

Position 1

Aib
2

Aminoisobutyric Acid

Position 2

Glu
3

Glutamic Acid

Position 3

Gly
4

Glycine

Position 4

Thr
5

Threonine

Position 5

Phe
6

Phenylalanine

Position 6

Thr
7

Threonine

Position 7

Ser
8

Serine

Position 8

Asp
9

Aspartic Acid

Position 9

Val
10

Valine

Position 10

Ser
11

Serine

Position 11

Ser
12

Serine

Position 12

Tyr
13

Tyrosine

Position 13

Leu
14

Leucine

Position 14

Glu
15

Glutamic Acid

Position 15

Gly
16

Glycine

Position 16

Gln
17

Glutamine

Position 17

Ala
18

Alanine

Position 18

Ala
19

Alanine

Position 19

Lys
20

Lysine

Position 20

Glu
21

Glutamic Acid

Position 21

Phe
22

Phenylalanine

Position 22

Ile
23

Isoleucine

Position 23

Ala
24

Alanine

Position 24

Trp
25

Tryptophan

Position 25

Leu
26

Leucine

Position 26

Val
27

Valine

Position 27

Arg
28

Arginine

Position 28

Gly
29

Glycine

Position 29

Arg
30

Arginine

Position 30

Gly
31

Glycine

Position 31

Pro
32

Proline

Position 32

Ser
33

Serine

Position 33

Ser
34

Serine

Position 34

Gly
35

Glycine

Position 35

Ala
36

Alanine

Position 36

Pro
37

Proline

Position 37

Pro
38

Proline

Position 38

Pro
39

Proline

Position 39

Ser
40

Serine

Position 40

N-terminus C-terminus
Hydrophobic
Polar
Positive (+)
Negative (-)
Modified

Modifications

C20 fatty acid conjugation Aib residues for DPP-4 resistance

Research Indications

The following information is derived from published scientific literature and is provided for educational and research reference purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. These peptides are not approved for human use and are sold exclusively for in-vitro laboratory research.

Superior Weight Reduction

Most Effective

Clinical trials show 17.5% weight loss at 24 weeks and 24.2% at 48 weeks.

Sustained Weight Management

Most Effective

Continuous weight loss with no plateau at 48 weeks suggests greater long-term potential.

Triple Mechanism

Most Effective

Addresses obesity through appetite suppression, energy expenditure, and metabolic efficiency.

Superior Glycemic Control

Most Effective

HbA1c reductions up to 2.16% with 82% achieving target levels below 6.5%.

Glucose-Dependent Regulation

Effective

Balanced glycemic control with minimal hypoglycemia risk.

Insulin Sensitivity

Effective

Marked improvements in sensitivity with potential for reduced exogenous insulin requirements.

Lipid Improvement

Effective

Non-HDL cholesterol reductions up to 26.9%, triglyceride reductions up to 40.6%.

Blood Pressure Optimization

Effective

Consistent decreases in systolic and diastolic blood pressure across trials.

Hepatic Fat Reduction

Most Effective

Up to 82% reduction in liver fat with normalization in 90% of participants.

Dosing Protocols

injectable

Weekly subcutaneous injection into abdomen, thigh, or upper arm with site rotation.

Goal Dose Frequency Route
Starting Dose (Week 1-4) 0.5mg Once weekly SubQ
Low Maintenance (Week 4-8) 1mg Once weekly SubQ
Escalation (Week 8-12) 2mg Once weekly SubQ
Moderate (Week 12-16) 4mg Once weekly SubQ
Advanced (Week 16-20) 8mg Once weekly SubQ
Maximum Efficacy (Week 20+) 12mg Once weekly SubQ

Key Tips

  • Once-weekly administration improves compliance
  • Extended half-life enables consistent hormone regulation
  • Minimal systemic burden compared to daily dosing
Materials Needed
Sterile bacteriostatic water for injection Lyophilized Retatrutide vial Insulin syringes (0.3-1mL capacity) Alcohol swabs Sharps disposal container
Steps
  1. 1 Allow vial to reach room temperature (15-20 minutes)
  2. 2 Clean vial top with alcohol swab and air dry completely
  3. 3 Add calculated bacteriostatic water slowly down vial side
  4. 4 Gently swirl in circular motions—avoid vigorous shaking
  5. 5 Allow full dissolution (2-3 minutes); solution should be clear and colorless
  6. 6 Store reconstituted solution refrigerated at 2-8°C for up to 28 days
  7. 7 Inject subcutaneously; rotate sites weekly

Peptide Interactions

Tirzepatide

Avoid

Do not combine with other dual/triple agonists—risk of severe hypoglycemia and excessive GI effects.

Semaglutide

Avoid

Do not combine—overlapping GLP-1 agonist mechanisms increase severe hypoglycemia risk.

Cagrilintide

Monitor

Both cause significant GI effects. Not recommended without specialist supervision.

Insulin

Monitor

May significantly reduce insulin requirements. Monitor blood glucose and adjust insulin doses accordingly.

Metformin

Compatible

Safe combination tested in clinical trials. Different mechanisms work complementarily for glucose control.

SGLT2 Inhibitors

Compatible

Clinical trials included SGLT2 inhibitors with no safety concerns.

BPC-157

Compatible

Safe combination; BPC-157 may provide GI protective benefits during retatrutide use.

Oral Contraceptives

Monitor

Space oral contraceptives by 1 hour before retatrutide due to delayed gastric emptying.

What to Expect

Week 1-2

Initial appetite suppression and mild GI effects as body adapts to triple hormone activation

Week 2-4

Noticeable food cravings reduction and portion size decrease; early weight loss (2-5%)

Week 4-8

Significant appetite control and steady weight loss (5-10%); improved glucose control

Week 8-16

Substantial weight reduction (10-18%) with enhanced energy expenditure

Week 16-24

Major weight loss milestone (15-22%) with cardiovascular benefits and liver fat reduction

Week 24-48

Maximum clinical efficacy (20-24.2%) with comprehensive metabolic improvements

Side Effects & Safety

Common Side Effects

  • Gastrointestinal effects (nausea, vomiting, diarrhea)—typically mild to moderate
  • Heart rate increases—common especially in first 24 weeks
  • Appetite suppression
  • Mild dehydration

Monitoring

  • Cardiovascular status (especially heart rate)
  • Blood glucose if diabetic
  • Weight loss rate
  • Signs of pancreatitis
  • Gastrointestinal tolerability

Stop Signs

  • Severe persistent nausea or vomiting preventing adequate nutrition
  • Signs of pancreatitis: severe abdominal pain radiating to back
  • Severe hypoglycemia symptoms: confusion, dizziness, sweating
  • Excessive weight loss (>3 lbs per week consistently or >25% total body weight)
  • Gallbladder problems: severe right upper abdominal pain

Contraindications

  • Personal or family history of medullary thyroid carcinoma
  • MEN2 syndrome
  • Severe renal impairment

Quality Checklist

Good Signs

  • Pharmaceutical-grade white powder with uniform texture
  • Proper cold chain maintenance (2-8°C refrigeration)
  • Clear, colorless reconstituted solution without particles
  • Stable extended half-life effects (consistent appetite suppression between doses)

Warning Signs

  • Source verification critical—counterfeit versions circulate due to investigational status

Bad Signs

  • Rapid tolerance or effectiveness loss suggests degraded or counterfeit product
  • Unusual side effect profile may indicate contamination

Research & References

Key References

2023

Phase II Obesity Trial

Landmark RCT in 338 participants showing dose-dependent weight loss; 12mg dose achieved 24.2% reduction—highest recorded for any obesity medication. NEJM.

2023

Phase II Type 2 Diabetes Study

Trial in 281 participants with type 2 diabetes: 16.9% weight loss and HbA1c reductions up to 2.16%. The Lancet.

2024

MASLD Substudy

Metabolic dysfunction-associated steatotic liver disease study: 82% liver fat reduction with normalization in >90% at highest doses. Nature Medicine.

2024

Structural Insights into Triple Agonism

Cryo-EM structures reveal simultaneous activation of GLP-1R, GIPR, and GCGR, explaining superior clinical efficacy. Cell Discovery.

Research Library

Retatrutide research & guides

Plain-English guides and study summaries from published literature.

View all 8
Retatrutide Not Working? Why the Foundation Matters More Than the Dose Guides 7 min

Retatrutide Not Working? Why the Foundation Matters More Than the Dose

Retatrutide is often discussed as a powerful tool for appetite control and body-composition change, but more is not always better. In many cases, hydration, electrolytes, protein intake, thyroid health and overall metabolic stability may matter far more than simply pushing the dose higher.

Read article
Retatrutide: why microdosing is wrong Guides 8 min

Retatrutide: why microdosing is wrong

You’ve probably heard online that microdosing retatrutide daily is the best approach to minimize side effects. And in this video, I’m going to teach you exactly why that’s wrong and show you how to dose this properly. By the end, you’ll understand why the microdosing protocols you see on TikTok and from influencers can’t work, no matter how good they sound.

Read article
Retatrutide Needs Carbohydrates to Work Properly Guides 8 min

Retatrutide Needs Carbohydrates to Work Properly

Retatrutide and Carbohydrates There’s a loud, confident, aggressively wrong idea floating around the internet: “If you’re using retatrutide, you should go low-carb.” And I’m telling you straight: for a lot of people, low-carb + retatrutide is a performance and body-composition sabotage package—especially if you train, care about lean mass, or want results that don’t boomerang later.

Read article
Microdosing Retatrutide Is Costing You Guides 4 min

Microdosing Retatrutide Is Costing You

The Science Behind GLP-1, GIP, and Glucagon Most explanations you hear are missing the only part that matters: GLP-1, GIP, and glucagon don’t behave the same “alone” as they do together. The combo changes the physics of the system. So if you’re still thinking “GLP-1 = appetite suppression” and calling it a day, you’re watching the trailer and missing the movie.

Read article
MOTS-C or Retatrutide Which One Is Better Guides 5 min

MOTS-C or Retatrutide Which One Is Better

The Power of Peptides: MOTS-C and Retatrutide People keep asking the wrong question: “When do I take MOTS-C vs Retatrutide?” The right question is: “What failure mode am I trying to fix?” Because yes—both can make you violently insulin sensitive (in the best way). But they do it through completely different control rooms in your biology. One is a mitochondrial operating system rewrite. The other is a triple-axis metabolic demolition and rebuild.

Read article
What Reta Actually Changes Guides 5 min

What Reta Actually Changes

Reta and Health Benefits Reta isn’t a “weight-loss drug.” If you treat it like that, you’ll misunderstand everything it’s actually doing. The scale is the distraction. The real story is the internal rebuild: liver, blood, inflammation, and—most importantly—your brain’s metabolic control center.

Read article

Get Peptide Price-drop Alerts

Be the first to know when prices drop on your favourite peptides

Select peptides you're interested in:

No spam. Unsubscribe anytime. We respect your privacy.