Plan your protocol — from reconstitution dosing to finding the cheapest cycle.
Compare live Tirzepatide prices from every UK supplier — side-by-side in seconds so you never overpay.
Prices last checked:
Copy the code — you'll paste it at checkout.
with our exclusive code
You're about to visit an external supplier
with our exclusive code
By clicking "Continue", you acknowledge that you understand and accept the above, including that these products are for research use only and are not for human consumption. Read our full disclosure.
Compare 67 prices for Tirzepatide. Cheapest: £21.99. Average: £109.69.
| Compare | Visit | |||||||
|---|---|---|---|---|---|---|---|---|
|
Tirzepatide 5mg |
£21.99 | £4.40/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 5mg |
£30.99 | £6.20/mg | In Stock | Free |
Lab Tested
|
— | ||
|
|
£39.00 | £3.90/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 5mg |
£39.95 | £7.99/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£42.99 | £8.60/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 10mg |
£44.99 | £4.50/mg | In Stock | Free |
Lab Tested
|
— | ||
|
|
£49.00 | £4.90/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 10mg |
£49.95 | £5.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 10mg |
£50.00 | £5.00/mg | In Stock | £5.00 |
Lab Tested
|
— | ||
|
Tirzepatide 20mg |
£57.99 | £2.90/mg | In Stock | Free |
Lab Tested
|
— | ||
|
|
£59.00 | £2.95/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£59.95 | £6.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 10mg |
£59.95 | £6.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 15mg |
£59.95 | £4.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 10mg |
£59.99 | £6.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 10mg |
£60.00 | £6.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 10mg |
£60.00 | £6.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 20mg |
£64.99 | £3.25/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 10mg |
£68.40 | £6.84/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 15mg |
£69.99 | £4.67/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 20mg |
£70.00 | £3.50/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 40mg |
£74.50 | £1.86/mg | In Stock | Free |
Lab Tested
|
— | Unavailable | |
|
Tirzepatide 30mg |
£78.00 | £2.60/mg | In Stock | Free |
Lab Tested
|
— | ||
|
|
£79.00 | £2.63/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 20mg |
£79.95 | £4.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 20mg Pen |
£79.99 | £4.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 10mg |
£80.00 | £8.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 10mg Pen |
£80.00 | £8.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£82.99 | £8.30/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£89.00 | £8.90/mg | In Stock | Free |
Lab Tested
|
— | ||
|
|
£94.00 | £2.09/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 50mg |
£94.50 | £1.89/mg | In Stock | Free |
Lab Tested
|
— | Unavailable | |
|
Tirzepatide 20mg |
£95.00 | £4.75/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 30mg |
£99.95 | £3.33/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 20mg |
£100.00 | £5.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 40mg |
£100.00 | £2.50/mg | In Stock | Free |
—
|
— | ||
|
|
£109.00 | £1.82/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
£110.00 | £3.67/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 60mg |
£114.50 | £1.91/mg | In Stock | Free |
Lab Tested
|
— | Unavailable | |
|
Tirzepatide 20mg Pen |
£115.00 | £5.75/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 30mg |
£119.99 | £4.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£119.99 | £8.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 40mg Pen |
£119.99 | £3.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 20mg Pen |
£120.00 | £6.00/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
£120.00 | £4.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 20mg |
£124.95 | £6.25/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 40mg |
£124.95 | £3.12/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 40mg |
£125.00 | £3.13/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide |
£134.99 | £6.75/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
£140.00 | £4.67/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 40mg Pen |
£145.00 | £3.63/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 50mg |
£149.95 | £3.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide |
£149.99 | £7.50/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 20mg |
£149.99 | £7.50/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 60mg |
£150.00 | £2.50/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 60mg |
£179.95 | £3.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 60mg |
£180.00 | £3.00/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide |
£189.99 | £4.75/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£199.00 | £6.63/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 40mg Pen |
£199.00 | £4.98/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 60mg |
£199.99 | £3.33/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 60mg |
£215.00 | £3.58/mg | In Stock | Free |
—
|
— | ||
|
Tirzepatide 40mg |
£219.99 | £5.50/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£239.00 | £5.98/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide |
£279.00 | £4.65/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 120mg |
£320.00 | £2.67/mg | In Stock | Free |
—
|
— |
More ways to compare Tirzepatide
Different views of the same live UK pricing, tuned for how you like to shop.
Compare another peptide
All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed.
Peptides on this site are intended exclusively for in-vitro laboratory research — not for human or animal consumption, therapeutic use, or self-administration.
We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed.
By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. Read our full disclosure.
Dual GIP/GLP-1 Receptor Agonist | Weight Loss & Diabetes
Revolutionary dual receptor agonist FDA-approved for type 2 diabetes and chronic weight management. Demonstrates efficacy superior to single-mechanism alternatives with 15-22% body weight reduction in clinical trials. The first-in-class dual GIP/GLP-1 agonist provides enhanced metabolic benefits compared to GLP-1-only medications.
Dual agonist targeting both GIP and GLP-1 receptors, producing glucose-dependent insulin stimulation, delayed gastric emptying, glucagon suppression, and central satiety signaling via hypothalamic pathways.
HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGGGGGPSKKKKKK
Histidine
Position 1
Aminoisobutyric Acid
Position 2
Glutamic Acid
Position 3
Glycine
Position 4
Threonine
Position 5
Phenylalanine
Position 6
Threonine
Position 7
Serine
Position 8
Aspartic Acid
Position 9
Valine
Position 10
Serine
Position 11
Serine
Position 12
Tyrosine
Position 13
Leucine
Position 14
Glutamic Acid
Position 15
Glycine
Position 16
Glutamine
Position 17
Alanine
Position 18
Alanine
Position 19
Lysine
Position 20
Glutamic Acid
Position 21
Phenylalanine
Position 22
Isoleucine
Position 23
Alanine
Position 24
Tryptophan
Position 25
Leucine
Position 26
Valine
Position 27
Arginine
Position 28
Glycine
Position 29
Arginine
Position 30
Glycine
Position 31
Glycine
Position 32
Glycine
Position 33
Glycine
Position 34
Glycine
Position 35
Proline
Position 36
Serine
Position 37
Lysine
Position 38
Lysine
Position 39
Lysine
Position 40
Lysine
Position 41
Lysine
Position 42
Lysine
Position 43
Clinical trials demonstrate 15-22% body weight reduction in non-diabetic obese individuals, superior to existing weight loss medications.
Improvements in waist circumference, blood pressure, triglycerides, HDL cholesterol, and insulin resistance markers.
Preferentially reduces visceral adipose tissue while preserving lean muscle mass with resistance training.
Superior HbA1c reduction of 1.5-2.4% in clinical trials.
Improves insulin sensitivity across diverse populations.
May help preserve and restore pancreatic beta cell function.
26% reduction in major adverse cardiovascular events demonstrated in SURPASS-CVOT trial.
Systolic and diastolic blood pressure reductions of 8-12 mmHg.
Triglyceride improvements of 20-30%, HDL enhancement, and apolipoprotein B reduction.
Once-weekly subcutaneous injection. Can be taken any time of day, with or without food. Injection sites include thigh, abdomen (2+ inches from navel), or upper arm.
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Weight loss initiation | 2.5mg | Once weekly x 4 weeks | SubQ injection |
| Weight loss progression | 5mg | Once weekly | SubQ injection |
| Weight loss optimization | 7.5-10mg | Once weekly | SubQ injection |
| Maximum weight loss | 12.5-15mg | Once weekly | SubQ injection |
| Diabetes management (mild) | 5-7.5mg | Once weekly | SubQ injection |
| Diabetes management (severe) | 10-15mg | Once weekly | SubQ injection |
Both are GLP-1 agonists—combining increases hypoglycemia and severe GI side effect risk.
Another GLP-1 agonist—dual therapy contraindicated due to additive effects.
May require significant insulin dose reduction due to improved sensitivity.
Complementary mechanisms for diabetes management and weight loss.
Growth hormone support may help preserve muscle mass during weight loss.
May help maintain metabolic rate and muscle preservation.
No known interactions, may support gut health and reduce GI effects.
NNMT inhibition may complement GLP-1 effects for metabolic optimization.
Appetite reduction begins
Improved blood sugar control (diabetics), mild nausea common
Initial weight loss begins; GI side effects typically improve
1-3 lbs weight loss per week during active phase
Peak weight loss effects observed
2,539 adults with obesity participants
15mg weekly achieved 22.5% weight loss vs 2.4% placebo over 72 weeks—largest weight loss in pharmaceutical trials.
13,000+ T2DM patients participants
Superior HbA1c reduction and weight loss compared to insulin, semaglutide, and existing diabetes medications.
938 adults with T2DM and obesity participants
15mg dose achieved 15.7% weight loss with significant cardiometabolic improvements over 72 weeks.
12,785 T2DM patients over 3.5 years participants
26% reduction in major adverse cardiovascular events, establishing cardioprotective benefits.
Be the first to know when prices drop on your favourite peptides
No spam. Unsubscribe anytime. We respect your privacy.