Live prices from 189 UK suppliers, from £12.50, compared side by side so you never overpay.
Copy the code — you'll paste it at checkout.
with our exclusive code
You're about to visit an external supplier
with our exclusive code
By clicking "Continue", you acknowledge that you understand and accept the above. Read our full disclosure.
Retatrutide
Retatrutide
Retatrutide
Retatrutide
Retatrutide
Retatrutide
Retatrutide 5mg
Retatrutide
Retatrutide
Retatrutide 5mg
Retatrutide 5mg
Retatrutide
Retatrutide 5mg
Retatrutide 5mg
Retatrutide
Retatrutide 5mg
Retatrutide 5mg
Compare 39 prices for Retatrutide. Cheapest: £19.99. Average: £54.22.
| Compare | Visit | |||||||
|---|---|---|---|---|---|---|---|---|
| £31.99 | £6.40/mg | In Stock | Free |
Lab Tested
|
— | |||
| £31.99 | £6.40/mg | In Stock | Free |
Lab Tested
|
— | |||
| £39.99 | £8.00/mg | In Stock | Free over £50 |
Lab Tested
|
— | |||
| £79.99 | £16.00/mg | In Stock | Free |
Lab Tested
|
— | |||
| £26.95 | £5.39/mg | In Stock | Free over £75 |
Lab Tested
|
— | |||
| £38.06 €44.49 EUR | £7.61/mg | In Stock | Free |
Lab Tested
|
— | |||
| £36.95 | £7.39/mg | Out of Stock | Free over £100 |
Lab Tested
|
— | |||
| £19.99 | £4.00/mg | In Stock | Free over £75 |
Lab Tested
|
— | |||
| £40.00 | £8.00/mg | In Stock | Free over £100 |
Lab Tested
|
— | |||
| £23.99 | £4.80/mg | In Stock | Free |
—
|
— | |||
| £20.95 | £4.19/mg | In Stock | £8.50 |
Lab Tested
|
— | |||
| £19.99 | £4.00/mg | Out of Stock | Free over £100 |
Lab Tested
|
— | |||
| £89.99 | £18.00/mg | In Stock | Free |
Lab Tested
|
— | |||
| £49.95 | £9.99/mg | Out of Stock | Free |
Lab Tested
|
— | |||
| £25.95 | £5.19/mg | In Stock | Free |
Lab Tested
|
— | |||
| £32.99 | £6.60/mg | Out of Stock | Free |
—
|
— | Unavailable | ||
| £34.99 | £7.00/mg | In Stock | Free |
Lab Tested
|
— | Unavailable | ||
| £39.00 | £7.80/mg | Low Stock | Free over £200 |
Lab Tested
|
— | |||
| £39.99 | £8.00/mg | Out of Stock | £9.99 |
—
|
— | |||
| £40.00 | £8.00/mg | In Stock | Free |
—
|
— | |||
| £49.95 | £9.99/mg | In Stock | Free |
Lab Tested
|
— | |||
| £49.95 | £9.99/mg | In Stock | Free |
—
|
— | Unavailable | ||
| £50.00 | £10.00/mg | In Stock | Free |
—
|
— | |||
| £54.50 | £10.90/mg | In Stock | Free |
Lab Tested
|
— | Unavailable | ||
| £55.00 | £11.00/mg | In Stock | Free |
—
|
— |
Showing 25 of 38 listings
More ways to compare Retatrutide
Different views of the same live UK pricing, tuned for how you like to shop.
Compare another peptide
All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed.
We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed.
By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. Read our full disclosure.
Triple GLP-1/GIP/Glucagon Agonist | Weight Loss & Diabetes
Novel triple hormone receptor agonist targeting GLP-1, GIP, and glucagon receptors. Phase II trials demonstrated 24.2% weight loss at 48 weeks—the highest recorded for obesity medications.
Activates GLP-1 for appetite suppression, GIP for insulin sensitivity, and glucagon for increased energy expenditure and hepatic fat oxidation.
HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPSSGAPPPS
Histidine
Position 1
Aminoisobutyric Acid
Position 2
Glutamic Acid
Position 3
Glycine
Position 4
Threonine
Position 5
Phenylalanine
Position 6
Threonine
Position 7
Serine
Position 8
Aspartic Acid
Position 9
Valine
Position 10
Serine
Position 11
Serine
Position 12
Tyrosine
Position 13
Leucine
Position 14
Glutamic Acid
Position 15
Glycine
Position 16
Glutamine
Position 17
Alanine
Position 18
Alanine
Position 19
Lysine
Position 20
Glutamic Acid
Position 21
Phenylalanine
Position 22
Isoleucine
Position 23
Alanine
Position 24
Tryptophan
Position 25
Leucine
Position 26
Valine
Position 27
Arginine
Position 28
Glycine
Position 29
Arginine
Position 30
Glycine
Position 31
Proline
Position 32
Serine
Position 33
Serine
Position 34
Glycine
Position 35
Alanine
Position 36
Proline
Position 37
Proline
Position 38
Proline
Position 39
Serine
Position 40
Clinical trials show 17.5% weight loss at 24 weeks and 24.2% at 48 weeks.
Continuous weight loss with no plateau at 48 weeks suggests greater long-term potential.
Addresses obesity through appetite suppression, energy expenditure, and metabolic efficiency.
HbA1c reductions up to 2.16% with 82% achieving target levels below 6.5%.
Balanced glycemic control with minimal hypoglycemia risk.
Marked improvements in sensitivity with potential for reduced exogenous insulin requirements.
Non-HDL cholesterol reductions up to 26.9%, triglyceride reductions up to 40.6%.
Consistent decreases in systolic and diastolic blood pressure across trials.
Up to 82% reduction in liver fat with normalization in 90% of participants.
Weekly subcutaneous injection into abdomen, thigh, or upper arm with site rotation.
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Starting Dose (Week 1-4) | 0.5mg | Once weekly | SubQ |
| Low Maintenance (Week 4-8) | 1mg | Once weekly | SubQ |
| Escalation (Week 8-12) | 2mg | Once weekly | SubQ |
| Moderate (Week 12-16) | 4mg | Once weekly | SubQ |
| Advanced (Week 16-20) | 8mg | Once weekly | SubQ |
| Maximum Efficacy (Week 20+) | 12mg | Once weekly | SubQ |
Do not combine with other dual/triple agonists—risk of severe hypoglycemia and excessive GI effects.
Do not combine—overlapping GLP-1 agonist mechanisms increase severe hypoglycemia risk.
Both cause significant GI effects. Not recommended without specialist supervision.
May significantly reduce insulin requirements. Monitor blood glucose and adjust insulin doses accordingly.
Safe combination tested in clinical trials. Different mechanisms work complementarily for glucose control.
Clinical trials included SGLT2 inhibitors with no safety concerns.
Safe combination; BPC-157 may provide GI protective benefits during retatrutide use.
Space oral contraceptives by 1 hour before retatrutide due to delayed gastric emptying.
Initial appetite suppression and mild GI effects as body adapts to triple hormone activation
Noticeable food cravings reduction and portion size decrease; early weight loss (2-5%)
Significant appetite control and steady weight loss (5-10%); improved glucose control
Substantial weight reduction (10-18%) with enhanced energy expenditure
Major weight loss milestone (15-22%) with cardiovascular benefits and liver fat reduction
Maximum clinical efficacy (20-24.2%) with comprehensive metabolic improvements
The New England journal of medicine · Jastreboff AM, Kaplan LM, Frías JP, Wu Q, Du Y, Gurbuz S, Coskun T, Haupt A, Milicevic Z, Hartman ML, Retatrutide Phase 2 Obesity Trial Investigators
This randomized phase 2 trial in adults with obesity reported dose-dependent body-weight reductions with retatrutide and gastrointestinal adverse events as the most common adverse-event category.
Plain-English guides and study summaries from published literature.
Guides
7 min
Retatrutide is often discussed as a powerful tool for appetite control and body-composition change, but more is not always better. In many cases, hydration, electrolytes, protein intake, thyroid health and overall metabolic stability may matter far more than simply pushing the dose higher.
Read article
Guides
8 min
You’ve probably heard online that microdosing retatrutide daily is the best approach to minimize side effects. And in this video, I’m going to teach you exactly why that’s wrong and show you how to dose this properly. By the end, you’ll understand why the microdosing protocols you see on TikTok and from influencers can’t work, no matter how good they sound.
Read article
Guides
8 min
Retatrutide and Carbohydrates There’s a loud, confident, aggressively wrong idea floating around the internet: “If you’re using retatrutide, you should go low-carb.” And I’m telling you straight: for a lot of people, low-carb + retatrutide is a performance and body-composition sabotage package—especially if you train, care about lean mass, or want results that don’t boomerang later.
Read article
Guides
4 min
The Science Behind GLP-1, GIP, and Glucagon Most explanations you hear are missing the only part that matters: GLP-1, GIP, and glucagon don’t behave the same “alone” as they do together. The combo changes the physics of the system. So if you’re still thinking “GLP-1 = appetite suppression” and calling it a day, you’re watching the trailer and missing the movie.
Read article
Guides
5 min
The Power of Peptides: MOTS-C and Retatrutide People keep asking the wrong question: “When do I take MOTS-C vs Retatrutide?” The right question is: “What failure mode am I trying to fix?” Because yes—both can make you violently insulin sensitive (in the best way). But they do it through completely different control rooms in your biology. One is a mitochondrial operating system rewrite. The other is a triple-axis metabolic demolition and rebuild.
Read article
Guides
5 min
Reta and Health Benefits Reta isn’t a “weight-loss drug.” If you treat it like that, you’ll misunderstand everything it’s actually doing. The scale is the distraction. The real story is the internal rebuild: liver, blood, inflammation, and—most importantly—your brain’s metabolic control center.
Read articleBe the first to know when prices drop on your favourite peptides
No spam. Unsubscribe anytime. We respect your privacy.